Clone FI15785 Report

Search the DGRC for FI15785

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:157
Well:85
Vector:pCR2.1
Associated Gene/TranscriptCG34189-RA
Protein status:FI15785.pep: gold
Sequenced Size:484

Clone Sequence Records

FI15785.complete Sequence

484 bp assembled on 2011-08-26

GenBank Submission: BT128857.1

> FI15785.complete
AGTAAAGGCTGGGAAACAAGTGGAAGTGATTGCTAATAGCTTCAGTTGCT
TTTGTTTTGCATGATGGTTTGGTTCAATTCCCTCTGCTTTCTGCTGCTGC
CGGCCTTGCTGATGGATTCGGTCATGACAACTGGCATCGACGAGGATCAT
ATCCTGAACCATGATGTGGACCCGGATCCGGGCCGCATGAAGTACATATG
GAATCCGTTTTCGGGATTTTGCGGCGAGAATGCCACCATGGTGAGGTGTG
CTGGAGTTTGCCCCGAAACCTGTGCCTTCAAATCGCTCAAGTGTCCCAAA
TATTGCGGTGTAAATTGCGTATGCAAACCTGACTATGTCTTTAACGAAAA
TCTGCAACTATGCATCCTTAAAACTGATTGTCCTCTAGACATAAAGCAAC
TGGTTGTTGAAACTCATCGCGTTTTTCAGTAAAAGCCTCAAAATATTTCT
GTGTTTTAAAAAGACAATAAACTAATGTTTGCAA

FI15785.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12641660..12642141 1..482 2365 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16754444..16754927 1..484 2420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16755643..16756126 1..484 2420 100 Plus
Blast to na_te.dros performed on 2019-03-15 10:58:17 has no hits.

FI15785.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:59:08 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12641660..12642141 1..482 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-08-26 15:07:20 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..369 64..432 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:31:18 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..369 64..432 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:17:42 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..369 64..432 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 15:07:20 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..369 64..432 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:31:18 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:42 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..482 1..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:08 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16754444..16754925 1..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:08 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16754444..16754925 1..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:59:08 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16754444..16754925 1..482 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:31:18 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12641949..12642430 1..482 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:46:17 Download gff for FI15785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16755643..16756124 1..482 100   Plus

FI15785.hyp Sequence

Translation from 60 to 431

> FI15785.hyp
MMVWFNSLCFLLLPALLMDSVMTTGIDEDHILNHDVDPDPGRMKYIWNPF
SGFCGENATMVRCAGVCPETCAFKSLKCPKYCGVNCVCKPDYVFNENLQL
CILKTDCPLDIKQLVVETHRVFQ*

FI15785.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34189-PA 122 CG34189-PA 1..122 2..123 689 100 Plus
CG5267-PA 178 CG5267-PA 99..177 44..122 193 48.1 Plus
Acp62F-PA 115 CG1262-PA 34..92 54..111 170 47.5 Plus
CG33259-PA 119 CG33259-PA 27..87 54..113 148 44.3 Plus

FI15785.pep Sequence

Translation from 60 to 431

> FI15785.pep
MMVWFNSLCFLLLPALLMDSVMTTGIDEDHILNHDVDPDPGRMKYIWNPF
SGFCGENATMVRCAGVCPETCAFKSLKCPKYCGVNCVCKPDYVFNENLQL
CILKTDCPLDIKQLVVETHRVFQ*

FI15785.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20050-PA 106 GF20050-PA 24..91 54..120 158 44.1 Plus
Dana\GF11405-PA 213 GF11405-PA 136..212 46..122 146 40.3 Plus
Dana\GF19794-PA 128 GF19794-PA 34..96 57..119 132 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20624-PA 200 GG20624-PA 106..199 26..122 178 42.3 Plus
Dere\GG14885-PA 131 GG14885-PA 29..87 54..111 153 47.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23083-PA 113 GH23083-PA 2..113 11..123 249 46.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34189-PA 122 CG34189-PA 1..122 2..123 689 100 Plus
CG5267-PB 201 CG5267-PB 122..200 44..122 193 48.1 Plus
Acp62F-PA 115 CG1262-PA 34..92 54..111 170 47.5 Plus
CG33259-PA 119 CG33259-PA 27..87 54..113 148 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11796-PA 98 GL11796-PA 6..98 31..123 333 67.7 Plus
Dper\Acp62F-PA 135 GL11209-PA 31..96 54..119 158 40.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18773-PB 96 GA18773-PB 4..96 31..123 333 67.7 Plus
Dpse\Acp62F-PA 135 GA24640-PA 31..96 54..119 156 40.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21718-PA 200 GM21718-PA 121..199 44..122 177 48.1 Plus
Dsec\Acp62F-PA 117 GM14509-PA 34..92 54..111 141 47.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp62F-PA 117 GD13705-PA 34..92 54..111 146 49.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20998-PA 107 GJ20998-PA 16..107 31..123 303 60.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19009-PA 106 GK19009-PA 3..105 21..122 175 38.8 Plus
Dwil\GK18908-PA 97 GK18908-PA 21..88 54..120 151 44.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11814-PA 198 GE11814-PA 119..197 44..122 179 48.1 Plus
Dyak\GE20336-PA 118 GE20336-PA 29..99 54..123 142 39.4 Plus