Clone Sequence Records
FI15849.complete Sequence
590 bp assembled on 2011-10-17
GenBank Submission: BT132699.1
> FI15849.complete
AGAAGGGATATATTATTCGCAGTGGGCCTTTGCCTTATGTTTAGTTTTCT
GAGCATTGAGGCTAGGTCATTGGAGGAAACCTCTGTCAAGACGAAACGCG
ATACCGACTGGTGGACTATCCTCGAGGATATACTCTATGACAATGATAGT
GATAGTGATGATGCCGGCGATGAGAACGTTTTGATTTGTCGTAACTGCAC
GGTAGTTGTTCAAGCTGCTCCAAACGCCACAGCGAATGGAAGCACTGTAG
CTCCGCAGGCAGGTGGAGCAGCTCCAGGGAGTTCACCAGGTGCGCCTGCC
ACTCCTCCTGGCTCGACTCCTGCAGTTCCAGCCACAGTTGCACCCGAAAC
GCCTGCTCCGTCGGCACCTGCGACATCGCCACAACCTGTAGTAACTGCCC
TACCCACAGCTGCCCCACCTACAGCTGCCCCACCCACAGCTGCCCCTGGT
GGTTAGATTATCTTATCCTTACCCACACCTTATAACACCTCTCTAACACT
AGCTATTAAATGGGATTTGGTATACGATAATGTTGCCCATGGGCTAATAA
CCCAGCTCAAATAAAACAGACGTTCATTCCGTTTTAAAAA
FI15849.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 4150644..4151047 | 182..585 | 2020 | 100 | Plus |
chr3R | 27901430 | chr3R | 4150358..4150450 | 1..93 | 450 | 98.9 | Plus |
chr3R | 27901430 | chr3R | 4150502..4150590 | 93..181 | 445 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8324627..8325031 | 182..586 | 2025 | 100 | Plus |
3R | 32079331 | 3R | 8324341..8324433 | 1..93 | 465 | 100 | Plus |
3R | 32079331 | 3R | 8324485..8324573 | 93..181 | 445 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:15:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 8065458..8065862 | 182..586 | 2025 | 100 | Plus |
3R | 31820162 | 3R | 8065172..8065264 | 1..93 | 465 | 100 | Plus |
3R | 31820162 | 3R | 8065316..8065404 | 93..181 | 445 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 11:25:22 has no hits.
FI15849.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:12 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 4150358..4150450 | 1..93 | 98 | -> | Plus |
chr3R | 4150503..4150590 | 94..181 | 100 | -> | Plus |
chr3R | 4150644..4151047 | 182..585 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-17 14:52:45 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7443-RA | 1..420 | 37..456 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:36 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7443-RA | 1..420 | 37..456 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:27 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7443-RA | 1..420 | 37..456 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-17 14:52:44 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7443-RA | 7..591 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:36 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7443-RA | 26..610 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:27 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7443-RA | 26..610 | 1..585 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:12 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8324341..8324433 | 1..93 | 100 | -> | Plus |
3R | 8324486..8324573 | 94..181 | 100 | -> | Plus |
3R | 8324627..8325030 | 182..585 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:12 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8324341..8324433 | 1..93 | 100 | -> | Plus |
3R | 8324486..8324573 | 94..181 | 100 | -> | Plus |
3R | 8324627..8325030 | 182..585 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:12 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8324341..8324433 | 1..93 | 100 | -> | Plus |
3R | 8324486..8324573 | 94..181 | 100 | -> | Plus |
3R | 8324627..8325030 | 182..585 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:36 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4150063..4150155 | 1..93 | 100 | -> | Plus |
arm_3R | 4150208..4150295 | 94..181 | 100 | -> | Plus |
arm_3R | 4150349..4150752 | 182..585 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:37:10 Download gff for
FI15849.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8065458..8065861 | 182..585 | 100 | | Plus |
3R | 8065172..8065264 | 1..93 | 100 | -> | Plus |
3R | 8065317..8065404 | 94..181 | 100 | -> | Plus |
FI15849.hyp Sequence
Translation from 0 to 455
> FI15849.hyp
RRDILFAVGLCLMFSFLSIEARSLEETSVKTKRDTDWWTILEDILYDNDS
DSDDAGDENVLICRNCTVVVQAAPNATANGSTVAPQAGGAAPGSSPGAPA
TPPGSTPAVPATVAPETPAPSAPATSPQPVVTALPTAAPPTAAPPTAAPG
G*
FI15849.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7443-PA | 139 | CG7443-PA | 1..139 | 13..151 | 727 | 100 | Plus |
CG7443-PB | 131 | CG7443-PB | 1..131 | 13..151 | 658 | 93.5 | Plus |
FI15849.pep Sequence
Translation from 0 to 455
> FI15849.pep
RRDILFAVGLCLMFSFLSIEARSLEETSVKTKRDTDWWTILEDILYDNDS
DSDDAGDENVLICRNCTVVVQAAPNATANGSTVAPQAGGAAPGSSPGAPA
TPPGSTPAVPATVAPETPAPSAPATSPQPVVTALPTAAPPTAAPPTAAPG
G*
FI15849.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:21:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25248-PA | 155 | GG25248-PA | 5..132 | 2..128 | 427 | 73.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7443-PA | 139 | CG7443-PA | 1..139 | 13..151 | 727 | 100 | Plus |
CG7443-PB | 131 | CG7443-PB | 1..131 | 13..151 | 658 | 93.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:21:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23725-PA | 151 | GM23725-PA | 4..128 | 1..128 | 496 | 86.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:21:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25870-PA | 152 | GE25870-PA | 4..119 | 1..116 | 403 | 75 | Plus |