Clone FI15849 Report

Search the DGRC for FI15849

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:158
Well:49
Vector:pOT2
Associated Gene/TranscriptCG7443-RA
Protein status:FI15849.pep: gold
Sequenced Size:590

Clone Sequence Records

FI15849.complete Sequence

590 bp assembled on 2011-10-17

GenBank Submission: BT132699.1

> FI15849.complete
AGAAGGGATATATTATTCGCAGTGGGCCTTTGCCTTATGTTTAGTTTTCT
GAGCATTGAGGCTAGGTCATTGGAGGAAACCTCTGTCAAGACGAAACGCG
ATACCGACTGGTGGACTATCCTCGAGGATATACTCTATGACAATGATAGT
GATAGTGATGATGCCGGCGATGAGAACGTTTTGATTTGTCGTAACTGCAC
GGTAGTTGTTCAAGCTGCTCCAAACGCCACAGCGAATGGAAGCACTGTAG
CTCCGCAGGCAGGTGGAGCAGCTCCAGGGAGTTCACCAGGTGCGCCTGCC
ACTCCTCCTGGCTCGACTCCTGCAGTTCCAGCCACAGTTGCACCCGAAAC
GCCTGCTCCGTCGGCACCTGCGACATCGCCACAACCTGTAGTAACTGCCC
TACCCACAGCTGCCCCACCTACAGCTGCCCCACCCACAGCTGCCCCTGGT
GGTTAGATTATCTTATCCTTACCCACACCTTATAACACCTCTCTAACACT
AGCTATTAAATGGGATTTGGTATACGATAATGTTGCCCATGGGCTAATAA
CCCAGCTCAAATAAAACAGACGTTCATTCCGTTTTAAAAA

FI15849.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4150644..4151047 182..585 2020 100 Plus
chr3R 27901430 chr3R 4150358..4150450 1..93 450 98.9 Plus
chr3R 27901430 chr3R 4150502..4150590 93..181 445 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8324627..8325031 182..586 2025 100 Plus
3R 32079331 3R 8324341..8324433 1..93 465 100 Plus
3R 32079331 3R 8324485..8324573 93..181 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8065458..8065862 182..586 2025 100 Plus
3R 31820162 3R 8065172..8065264 1..93 465 100 Plus
3R 31820162 3R 8065316..8065404 93..181 445 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:25:22 has no hits.

FI15849.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:12 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4150358..4150450 1..93 98 -> Plus
chr3R 4150503..4150590 94..181 100 -> Plus
chr3R 4150644..4151047 182..585 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-17 14:52:45 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 1..420 37..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:36 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 1..420 37..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:27 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 1..420 37..456 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-17 14:52:44 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 7..591 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:36 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 26..610 1..585 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:27 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 26..610 1..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:12 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8324341..8324433 1..93 100 -> Plus
3R 8324486..8324573 94..181 100 -> Plus
3R 8324627..8325030 182..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:12 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8324341..8324433 1..93 100 -> Plus
3R 8324486..8324573 94..181 100 -> Plus
3R 8324627..8325030 182..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:12 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8324341..8324433 1..93 100 -> Plus
3R 8324486..8324573 94..181 100 -> Plus
3R 8324627..8325030 182..585 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:36 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4150063..4150155 1..93 100 -> Plus
arm_3R 4150208..4150295 94..181 100 -> Plus
arm_3R 4150349..4150752 182..585 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:37:10 Download gff for FI15849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8065458..8065861 182..585 100   Plus
3R 8065172..8065264 1..93 100 -> Plus
3R 8065317..8065404 94..181 100 -> Plus

FI15849.hyp Sequence

Translation from 0 to 455

> FI15849.hyp
RRDILFAVGLCLMFSFLSIEARSLEETSVKTKRDTDWWTILEDILYDNDS
DSDDAGDENVLICRNCTVVVQAAPNATANGSTVAPQAGGAAPGSSPGAPA
TPPGSTPAVPATVAPETPAPSAPATSPQPVVTALPTAAPPTAAPPTAAPG
G*

FI15849.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-PA 139 CG7443-PA 1..139 13..151 727 100 Plus
CG7443-PB 131 CG7443-PB 1..131 13..151 658 93.5 Plus

FI15849.pep Sequence

Translation from 0 to 455

> FI15849.pep
RRDILFAVGLCLMFSFLSIEARSLEETSVKTKRDTDWWTILEDILYDNDS
DSDDAGDENVLICRNCTVVVQAAPNATANGSTVAPQAGGAAPGSSPGAPA
TPPGSTPAVPATVAPETPAPSAPATSPQPVVTALPTAAPPTAAPPTAAPG
G*

FI15849.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25248-PA 155 GG25248-PA 5..132 2..128 427 73.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-PA 139 CG7443-PA 1..139 13..151 727 100 Plus
CG7443-PB 131 CG7443-PB 1..131 13..151 658 93.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23725-PA 151 GM23725-PA 4..128 1..128 496 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25870-PA 152 GE25870-PA 4..119 1..116 403 75 Plus