Clone FI15873 Report

Search the DGRC for FI15873

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:158
Well:73
Vector:pOT2
Associated Gene/TranscriptDhfr-RA
Protein status:FI15873.pep: gold
Sequenced Size:620

Clone Sequence Records

FI15873.complete Sequence

620 bp assembled on 2011-10-17

GenBank Submission: BT132691.1

> FI15873.complete
GAAGATAATTTTCAAGCTTATGCTTTCTCAGTAAGGATTAAGGATGCTTC
GATTCAATTTAATCGTGGCAGTTTGCGAGAATTTCGGAATCGGCATCAGA
GGCGATCTACCATGGCGCATTAAATCTGAGCTGAAGTACTTCAGCCGCAC
CACCAAGCGAACAAGTGATCCCACCAAGCAAAATGCCGTGGTAATGGGCA
GGAAAACCTACTTCGGAGTGCCGGAAAGCAAGAGGCCTCTTCCCGATCGG
CTGAACATAGTGCTGAGCACCACACTTCAGGAAAGTGATCTGCCCAAGGG
AGTACTATTGTGCCCCAATCTCGAGACGGCCATGAAGATCCTTGAGGAGC
AGAACGAAGTGGAGAACATTTGGATTGTGGGCGGTAGTGGAGTCTACGAG
GAGGCCATGGCCTCGCCAAGGTGTCACCGGCTGTACATTACCAAAATAAT
GCAGAAGTTCGATTGCGACACCTTTTTCCCCGCGATCCCTGACAGCTTTC
GAGAGGTCGCGCCCGATTCCGACATGCCACTGGGTGTGCAGGAGGAGAAT
GGCATTAAATTCGAGTACAAGATTTTGGAGAAACACTCATAATAAAATAA
TACACTGATTTAAAAAAAAA

FI15873.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12306068..12306555 124..611 2440 100 Plus
chr3R 27901430 chr3R 12305895..12306017 1..123 615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16481391..16481879 124..612 2445 100 Plus
3R 32079331 3R 16481218..16481340 1..123 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16222222..16222710 124..612 2445 100 Plus
3R 31820162 3R 16222049..16222171 1..123 615 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:25:48 has no hits.

FI15873.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:27 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12305895..12306017 1..123 100 -> Plus
chr3R 12306068..12306555 124..611 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-17 15:21:35 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
Dhfr-RB 1..549 44..592 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:54 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
Dhfr-RA 1..549 44..592 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:59 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
Dhfr-RA 1..549 44..592 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-17 15:21:34 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
Dhfr-RB 20..630 1..611 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:54 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
Dhfr-RB 52..662 1..611 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:59 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
Dhfr-RB 52..662 1..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:27 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16481218..16481340 1..123 100 -> Plus
3R 16481391..16481878 124..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:27 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16481218..16481340 1..123 100 -> Plus
3R 16481391..16481878 124..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:27 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16481218..16481340 1..123 100 -> Plus
3R 16481391..16481878 124..611 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:54 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12306940..12307062 1..123 100 -> Plus
arm_3R 12307113..12307600 124..611 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:37:13 Download gff for FI15873.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16222222..16222709 124..611 100   Plus
3R 16222049..16222171 1..123 100 -> Plus

FI15873.hyp Sequence

Translation from 43 to 591

> FI15873.hyp
MLRFNLIVAVCENFGIGIRGDLPWRIKSELKYFSRTTKRTSDPTKQNAVV
MGRKTYFGVPESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKIL
EEQNEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIPD
SFREVAPDSDMPLGVQEENGIKFEYKILEKHS*

FI15873.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dhfr-PB 182 CG14887-PB 1..182 1..182 956 100 Plus
Dhfr-PA 182 CG14887-PA 1..182 1..182 956 100 Plus

FI15873.pep Sequence

Translation from 43 to 591

> FI15873.pep
MLRFNLIVAVCENFGIGIRGDLPWRIKSELKYFSRTTKRTSDPTKQNAVV
MGRKTYFGVPESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKIL
EEQNEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIPD
SFREVAPDSDMPLGVQEENGIKFEYKILEKHS*

FI15873.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18503-PA 183 GF18503-PA 1..182 1..182 793 78.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17010-PA 183 GG17010-PA 1..182 1..182 851 84.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19291-PA 184 GH19291-PA 1..184 1..181 674 68.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dhfr-PB 182 CG14887-PB 1..182 1..182 956 100 Plus
Dhfr-PA 182 CG14887-PA 1..182 1..182 956 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23507-PA 188 GI23507-PA 1..183 1..180 738 74.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22182-PA 185 GL22182-PA 1..184 1..181 782 77.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13324-PA 185 GA13324-PA 1..184 1..181 776 77.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15163-PA 182 GM15163-PA 1..182 1..182 955 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19106-PA 182 GD19106-PA 1..182 1..182 957 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10259-PA 186 GJ10259-PA 1..186 1..181 752 75.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11864-PA 183 GK11864-PA 1..182 1..181 710 69.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24403-PA 181 GE24403-PA 1..181 1..181 864 87.8 Plus