Clone FI15907 Report

Search the DGRC for FI15907

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:159
Well:7
Vector:pOT2
Associated Gene/TranscriptTaf11-RA
Protein status:FI15907.pep: gold
Sequenced Size:749

Clone Sequence Records

FI15907.complete Sequence

749 bp assembled on 2011-10-27

GenBank Submission: BT132724.1

> FI15907.complete
ATTTTGTTTATTATTCGCTGGTGCTTTTCAAATTTCATTTAAATGGACGA
AATCCTCTTTCCCACGCAGCAAAAAAGCAACTCCCTAAGCGACGGCGACG
ATGTCGACCTGAAATTCTTCCAGTCGGCCTCCGGCGAGCGGAAGGACAGC
GACACCTCGGATCCGGGAAACGATGCGGATCGTGATGGCAAGGATGCGGA
TGGGGACAACGACAACAAGAACACGGACGGAGATGGTGACTCTGGCGAGC
CGGCGCACAAAAAGCTCAAGACGAAGAAGGAACTGGAGGAGGAGGAGCGC
GAACGAATGCAGGTTCTCGTTTCCAACTTTACGGAAGAACAGCTGGATCG
CTACGAAATGTATCGTCGCTCTGCCTTTCCCAAGGCCGCCGTCAAGCGTC
TAATGCAAACTATCACCGGCTGTTCCGTGTCCCAGAATGTTGTGATAGCC
ATGTCCGGCATTGCGAAGGTCTTCGTCGGCGAGGTTGTGGAGGAAGCCCT
CGACGTGATGGAGGCCCAAGGTGAATCCGGTGCCCTGCAGCCCAAATTCA
TACGAGAGGCAGTGCGACGACTGAGGACCAAGGATCGGATGCCCATAGGC
AGATACCAGCAGCCCTATTTCAGACTGAACTAGCGAGTCGAGACATTAAG
AAATATAGTTTGTAAGGCTGTTAGTCAATATAAAAATACATAAACAAGTA
AAAAGTAAATAAATATAAAGATTTTTTTAACAAAAAAAAAAAAAAAAAA

FI15907.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9761263..9761682 731..312 2100 100 Minus
chr2L 23010047 chr2L 9761744..9762055 312..1 1545 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9762421..9762843 734..312 2115 100 Minus
2L 23513712 2L 9762905..9763216 312..1 1560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9762421..9762843 734..312 2115 100 Minus
2L 23513712 2L 9762905..9763216 312..1 1560 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:37:53 has no hits.

FI15907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:38:45 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9761745..9762055 1..311 99   Minus
chr2L 9761263..9761682 312..731 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-27 08:56:52 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
Taf11-RA 1..591 43..633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:14 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
Taf11-RA 1..591 43..633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:39:44 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
Taf11-RA 1..591 43..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-27 08:56:52 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
Taf11-RA 29..759 1..731 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:14 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
Taf11-RA 47..777 1..731 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:39:44 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
Taf11-RA 47..777 1..731 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:45 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9762424..9762843 312..731 100 <- Minus
2L 9762906..9763216 1..311 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:45 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9762424..9762843 312..731 100 <- Minus
2L 9762906..9763216 1..311 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:45 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9762424..9762843 312..731 100 <- Minus
2L 9762906..9763216 1..311 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:14 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9762424..9762843 312..731 100 <- Minus
arm_2L 9762906..9763216 1..311 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:37:43 Download gff for FI15907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9762424..9762843 312..731 100 <- Minus
2L 9762906..9763216 1..311 100   Minus

FI15907.pep Sequence

Translation from 42 to 632

> FI15907.pep
MDEILFPTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGK
DADGDNDNKNTDGDGDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQ
LDRYEMYRRSAFPKAAVKRLMQTITGCSVSQNVVIAMSGIAKVFVGEVVE
EALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYFRLN*

FI15907.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21885-PA 197 GF21885-PA 1..196 1..195 806 88.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24011-PA 196 GG24011-PA 1..196 1..196 1012 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25071-PA 192 GH25071-PA 1..192 1..196 723 81.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Taf11-PA 196 CG4079-PA 1..196 1..196 1002 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18207-PA 185 GI18207-PA 1..185 1..196 711 83.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19212-PA 195 GL19212-PA 1..195 1..196 849 91.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17941-PA 195 GA17941-PA 1..195 1..196 849 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12298-PA 196 GM12298-PA 1..196 1..196 1028 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22339-PA 196 GD22339-PA 1..196 1..196 1028 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14786-PA 190 GJ14786-PA 1..190 1..196 739 83.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24821-PA 197 GK24821-PA 1..197 1..196 757 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10358-PA 196 GE10358-PA 1..196 1..196 1016 97.4 Plus

FI15907.hyp Sequence

Translation from 42 to 632

> FI15907.hyp
MDEILFPTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGK
DADGDNDNKNTDGDGDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQ
LDRYEMYRRSAFPKAAVKRLMQTITGCSVSQNVVIAMSGIAKVFVGEVVE
EALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYFRLN*

FI15907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Taf11-PA 196 CG4079-PA 1..196 1..196 1002 100 Plus