Clone FI15955 Report

Search the DGRC for FI15955

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:159
Well:55
Vector:pOT2
Associated Gene/TranscriptCG11882-RA
Protein status:FI15955.pep: gold
Sequenced Size:1025

Clone Sequence Records

FI15955.complete Sequence

1025 bp assembled on 2011-10-27

GenBank Submission: BT132722.1

> FI15955.complete
TTTAAATTTTGCTCCCATAAATTCCAACTTTTTGTCACTTAAAGCATGTG
CGAAAAGGTCACCGCGCGCTGCACTTGGCCCCAGCTGTCGGGCAACGGGC
TGGACCAACTGGTGGCCACCCGCTTGTCCGACGAAGACGTCTTTGTGAAG
CCCGACTTGGACGACGTGATCGACGAGAATCGCGCCGTGCTGTTTTCCAT
GCAGTCGGCGGATCCGCCGCCGCCTTGTGAGCTGCGCTTCCAGATCCCGA
ACCGCTTCAAAATCGCCGCGCTCACCCTGATTTGCAGCGCTCCCAAGGTG
GAGCTGTTCATTGGACCCTTGCAGGAGTACTGCGAGACCATCTACGGCAC
TTGCGTCGACGATGAGGACCCAGAGGTTGCGGTGCGACCCTATCGCTATG
ACATGGAAATCGACCGATCCGGGATAAATGACATAAACCTGAAGATGCTC
ACCTCGGCCAGCGAGATCTGCGTTTACGGAGCCCTGCTCCAGGTGGCGCC
GAATCCCAACGGCATAACCACCCAGTTGCCCAGGCCAATGGATGCGCAGC
GAATCCAAGAGCTGCTGCAAAGGGGTGGCACGAGTCCCTTGAAGAAGGAG
GAGCAGGCCGAAAAGTTCGAGCAGTTCATGAGCCTGATGAAGGGCTATTC
CCCGCAGGCGAAGGACCAAACCCAAGAGACTGCACCGCCTTCCACCGATG
TTGCAATCCTCAAGGAGCACATCGACATGAGATTTGAGAAGCTGACGCTG
TTAGTGTCTAAGAGACTGGACAACTTCGAGGCCCAGCAGACGGAAAAGTT
AAACAAAATTATTGCCTTGCTGGAAAAGGAAAAATAAGTAATATACCATT
AATTTGCTAATCTGTAATTTCTTTCTTAGCATTGTCATCATTGTATTTTG
TAATTGTTGTAAAAGACTGTTGGTGCGAATATTTCGAATGTGATTAGGCA
ACATATTTAAGTTTGGTTTTGAATGTAATGTACATTAAATAAAATATTCT
TCTCTTAAAAAAAAAAAAAAAAAAA

FI15955.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24969890..24970746 1006..150 4090 98.5 Minus
chr3R 27901430 chr3R 24970816..24970965 150..1 750 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29147020..29147880 1010..150 4305 100 Minus
3R 32079331 3R 29147950..29148099 150..1 750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28887851..28888711 1010..150 4305 100 Minus
3R 31820162 3R 28888781..28888930 150..1 750 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:38:03 has no hits.

FI15955.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:38:51 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24969890..24970746 150..1006 98 <- Minus
chr3R 24970817..24970965 1..149 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-27 08:56:55 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
CG11882-RA 1..792 46..837 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:20 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
CG11882-RA 1..792 46..837 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:39:58 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
CG11882-RA 1..792 46..837 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-27 08:56:54 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
CG11882-RA 74..1079 1..1006 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:20 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
CG11882-RA 74..1079 1..1006 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:39:58 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
CG11882-RA 74..1079 1..1006 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:51 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29147024..29147880 150..1006 100 <- Minus
3R 29147951..29148099 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:51 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29147024..29147880 150..1006 100 <- Minus
3R 29147951..29148099 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:51 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29147024..29147880 150..1006 100 <- Minus
3R 29147951..29148099 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:20 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24972746..24973602 150..1006 100 <- Minus
arm_3R 24973673..24973821 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:37:44 Download gff for FI15955.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28887855..28888711 150..1006 100 <- Minus
3R 28888782..28888930 1..149 100   Minus

FI15955.hyp Sequence

Translation from 45 to 836

> FI15955.hyp
MCEKVTARCTWPQLSGNGLDQLVATRLSDEDVFVKPDLDDVIDENRAVLF
SMQSADPPPPCELRFQIPNRFKIAALTLICSAPKVELFIGPLQEYCETIY
GTCVDDEDPEVAVRPYRYDMEIDRSGINDINLKMLTSASEICVYGALLQV
APNPNGITTQLPRPMDAQRIQELLQRGGTSPLKKEEQAEKFEQFMSLMKG
YSPQAKDQTQETAPPSTDVAILKEHIDMRFEKLTLLVSKRLDNFEAQQTE
KLNKIIALLEKEK*

FI15955.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11882-PB 263 CG11882-PB 1..263 1..263 1360 100 Plus
CG11882-PA 263 CG11882-PA 1..263 1..263 1360 100 Plus

FI15955.pep Sequence

Translation from 45 to 836

> FI15955.pep
MCEKVTARCTWPQLSGNGLDQLVATRLSDEDVFVKPDLDDVIDENRAVLF
SMQSADPPPPCELRFQIPNRFKIAALTLICSAPKVELFIGPLQEYCETIY
GTCVDDEDPEVAVRPYRYDMEIDRSGINDINLKMLTSASEICVYGALLQV
APNPNGITTQLPRPMDAQRIQELLQRGGTSPLKKEEQAEKFEQFMSLMKG
YSPQAKDQTQETAPPSTDVAILKEHIDMRFEKLTLLVSKRLDNFEAQQTE
KLNKIIALLEKEK*

FI15955.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22937-PA 246 GF22937-PA 1..245 1..263 828 59.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12034-PA 263 GG12034-PA 1..263 1..263 1301 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14011-PA 276 GH14011-PA 1..273 1..260 761 57.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11882-PB 263 CG11882-PB 1..263 1..263 1360 100 Plus
CG11882-PA 263 CG11882-PA 1..263 1..263 1360 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24381-PA 264 GI24381-PA 1..264 1..263 820 59.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23602-PA 291 GL23602-PA 1..288 1..260 848 59.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11257-PA 287 GA11257-PA 1..284 1..260 826 58.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12259-PA 263 GM12259-PA 1..263 1..263 1325 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17950-PA 263 GD17950-PA 1..263 1..263 1343 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14237-PA 267 GJ14237-PA 1..266 1..262 826 59.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11186-PA 267 GK11186-PA 3..259 2..259 735 56 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10472-PA 264 GE10472-PA 1..263 1..262 1295 93.2 Plus