Clone FI15961 Report

Search the DGRC for FI15961

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:159
Well:61
Vector:pOT2
Associated Gene/TranscriptCG2016-RB
Protein status:FI15961.pep: gold
Sequenced Size:873

Clone Sequence Records

FI15961.complete Sequence

873 bp assembled on 2011-10-27

GenBank Submission: BT132726.1

> FI15961.complete
GAAAGTTGGACGCAAAACGAACCCGAAAAATGAGCGGAAAGATGGTCTTC
ATTGTGCTCGTCGCCGTGTTGGGCTCCACTTTTGCCCAGGAGCAGCCCTA
CTACCTGCAACAGTGCCCACGGGACGAGGCCCAGATAAACGAATGCCTTC
GCGAAAGTGGCAACAAGCTGGTGCACTACCTGCAGAAGGGAGTGCCGGAG
TTGGACATCTATGAGATCGAACCCGTGATGATTGATGAAATCGGCATTGT
GTTGGGCAGTGGTCCGGATGGCTACCGCGCACTTTTCCGGAACATTCAGG
CCTACGGTGTGAGCAATATCACAGTGACCAACATCCGCTCCGACTTGGAC
TCGCTGCAGTTCCAGCTGACGTGCGAGATACCCCGCATTCGCGTCAAGGC
GCAGTACCGGTCCACAGGTGTTCTGATCTTGGTGAAGGCCTCCGGAGCCG
GCGACTACTGGGGGGAGTACGAGGGAGTTAAGGCCAAGATCTACTTCAAG
GCGGTGGCCAATGAGGGTCCCGACGGTCGCACCTACCTGACGACGGACTC
CGTCAAGATGGACTTCAACGTGAAGGAGATCCAAATGGGTGTGGACAACA
TCGCCAATGGCAACACAGTGATACAGGCTGCTCTCAATCTGTTCATCAAC
TCCAACTCCCAGGAGCTGCTCAAGGAAATGAAGCCGGCGCTCAGGACCAA
ACTCACTCTGGTCATCCGCAACTTCATGGATCGCATATTCGCCAAGATTC
CGCTGGACGAGTGGATCAACCTGAATTAGAATGTAGTTTCTCTAGTCTAA
GACCTTATTTATTGCACACAGTTCCGCGAAATATACCAAGTAAATGGACA
AAAAAAAAAAAAAAAAAAAAAAA

FI15961.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 782680..782904 849..625 1110 99.6 Minus
chr3R 27901430 chr3R 782971..783124 624..471 770 100 Minus
chr3R 27901430 chr3R 783182..783316 471..337 675 100 Minus
chr3R 27901430 chr3R 785318..785441 337..214 620 100 Minus
chr3R 27901430 chr3R 785585..785703 215..97 595 100 Minus
chr3R 27901430 chr3R 786575..786654 96..17 400 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4956999..4957223 849..625 1110 99.6 Minus
3R 32079331 3R 4957290..4957443 624..471 770 100 Minus
3R 32079331 3R 4957501..4957635 471..337 675 100 Minus
3R 32079331 3R 4959637..4959760 337..214 620 100 Minus
3R 32079331 3R 4959904..4960022 215..97 595 100 Minus
3R 32079331 3R 4960894..4960973 96..17 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4697830..4698054 849..625 1110 99.5 Minus
3R 31820162 3R 4698121..4698274 624..471 770 100 Minus
3R 31820162 3R 4698332..4698466 471..337 675 100 Minus
3R 31820162 3R 4700468..4700591 337..214 620 100 Minus
3R 31820162 3R 4700735..4700853 215..97 595 100 Minus
3R 31820162 3R 4701725..4701804 96..17 400 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:38:22 has no hits.

FI15961.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:39:03 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 782680..782904 625..849 99 <- Minus
chr3R 782971..783123 472..624 100 <- Minus
chr3R 783182..783315 338..471 100 <- Minus
chr3R 785318..785439 216..337 100 <- Minus
chr3R 785585..785703 97..215 100 <- Minus
chr3R 786575..786654 17..96 100 <- Minus
chr3R 786993..787008 1..16 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-10-27 09:20:01 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
CG2016-RB 1..750 30..779 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:32 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
CG2016-RB 1..750 30..779 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:40:22 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
CG2016-RB 1..750 30..779 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-27 09:19:59 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
CG2016-RB 22..870 1..849 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:32 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
CG2016-RB 25..873 1..849 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:40:22 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
CG2016-RB 25..873 1..849 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:39:03 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4957501..4957634 338..471 100 <- Minus
3R 4959637..4959758 216..337 100 <- Minus
3R 4959904..4960022 97..215 100 <- Minus
3R 4960894..4960973 17..96 100 <- Minus
3R 4961312..4961327 1..16 100   Minus
3R 4956999..4957223 625..849 99 <- Minus
3R 4957290..4957442 472..624 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:39:03 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4957501..4957634 338..471 100 <- Minus
3R 4959637..4959758 216..337 100 <- Minus
3R 4959904..4960022 97..215 100 <- Minus
3R 4960894..4960973 17..96 100 <- Minus
3R 4961312..4961327 1..16 100   Minus
3R 4956999..4957223 625..849 99 <- Minus
3R 4957290..4957442 472..624 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:39:03 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4957501..4957634 338..471 100 <- Minus
3R 4959637..4959758 216..337 100 <- Minus
3R 4959904..4960022 97..215 100 <- Minus
3R 4960894..4960973 17..96 100 <- Minus
3R 4961312..4961327 1..16 100   Minus
3R 4956999..4957223 625..849 99 <- Minus
3R 4957290..4957442 472..624 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:32 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 785626..785744 97..215 100 <- Minus
arm_3R 786616..786695 17..96 100 <- Minus
arm_3R 787034..787049 1..16 100   Minus
arm_3R 782721..782945 625..849 99 <- Minus
arm_3R 783012..783164 472..624 100 <- Minus
arm_3R 783223..783356 338..471 100 <- Minus
arm_3R 785359..785480 216..337 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:37:47 Download gff for FI15961.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4697830..4698054 625..849 99 <- Minus
3R 4698121..4698273 472..624 100 <- Minus
3R 4698332..4698465 338..471 100 <- Minus
3R 4700468..4700589 216..337 100 <- Minus
3R 4700735..4700853 97..215 100 <- Minus
3R 4701725..4701804 17..96 100 <- Minus
3R 4702143..4702158 1..16 100   Minus

FI15961.hyp Sequence

Translation from 2 to 778

> FI15961.hyp
KLDAKRTRKMSGKMVFIVLVAVLGSTFAQEQPYYLQQCPRDEAQINECLR
ESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYRALFRNIQA
YGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASGAG
DYWGEYEGVKAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDNI
ANGNTVIQAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIP
LDEWINLN*

FI15961.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG2016-PD 249 CG2016-PD 1..249 10..258 1274 100 Plus
CG2016-PB 249 CG2016-PB 1..249 10..258 1274 100 Plus
CG2016-PE 254 CG2016-PE 1..254 10..258 1255 97.6 Plus
CG2016-PC 183 CG2016-PC 1..183 76..258 931 100 Plus
CG1124-PA 246 CG1124-PA 3..243 13..254 370 29.8 Plus

FI15961.pep Sequence

Translation from 2 to 778

> FI15961.pep
KLDAKRTRKMSGKMVFIVLVAVLGSTFAQEQPYYLQQCPRDEAQINECLR
ESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYRALFRNIQA
YGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASGAG
DYWGEYEGVKAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDNI
ANGNTVIQAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIP
LDEWINLN*

FI15961.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16078-PA 249 GF16078-PA 1..249 10..258 1258 94.8 Plus
Dana\GF18921-PA 246 GF18921-PA 20..243 30..254 370 30.2 Plus
Dana\GF11902-PA 266 GF11902-PA 38..265 29..255 336 29.4 Plus
Dana\GF11323-PA 261 GF11323-PA 34..256 32..255 290 26.7 Plus
Dana\GF20756-PA 251 GF20756-PA 19..246 23..252 216 24.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11255-PA 249 GG11255-PA 1..249 10..258 1267 95.6 Plus
Dere\GG12598-PA 246 GG12598-PA 3..243 13..254 384 30.2 Plus
Dere\GG16974-PA 269 GG16974-PA 41..268 29..255 324 28.9 Plus
Dere\GG20212-PA 259 GG20212-PA 35..257 32..255 261 24.4 Plus
Dere\GG11299-PA 251 GG11299-PA 7..246 14..252 216 24.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15279-PA 249 GH15279-PA 1..249 10..258 1206 90 Plus
Dgri\GH17330-PA 244 GH17330-PA 7..241 18..254 353 29.6 Plus
Dgri\GH18760-PA 268 GH18760-PA 40..267 29..255 335 29.8 Plus
Dgri\GH18842-PA 260 GH18842-PA 33..255 32..255 274 26.5 Plus
Dgri\GH15290-PA 247 GH15290-PA 10..239 18..241 228 26.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG2016-PD 249 CG2016-PD 1..249 10..258 1274 100 Plus
CG2016-PB 249 CG2016-PB 1..249 10..258 1274 100 Plus
CG2016-PE 254 CG2016-PE 1..254 10..258 1255 97.6 Plus
CG2016-PC 183 CG2016-PC 1..183 76..258 931 100 Plus
CG1124-PA 246 CG1124-PA 3..243 13..254 370 29.8 Plus
CG10264-PA 270 CG10264-PA 42..269 29..255 321 28.9 Plus
CG10407-PB 259 CG10407-PB 31..255 28..253 274 25.6 Plus
CG10407-PA 259 CG10407-PA 31..255 28..253 274 25.6 Plus
CG10407-PC 263 CG10407-PC 31..259 28..253 260 25.1 Plus
CG13618-PA 252 CG13618-PA 3..247 9..252 222 24.9 Plus
CG14661-PB 246 CG14661-PB 6..238 14..241 206 23.7 Plus
CG14661-PA 246 CG14661-PA 6..238 14..241 206 23.7 Plus
CG11852-PA 250 CG11852-PA 25..245 37..253 190 21.6 Plus
CG11854-PB 250 CG11854-PB 7..246 17..253 187 24.4 Plus
CG14259-PA 289 CG14259-PA 38..269 27..255 174 21.9 Plus
CG14457-PB 271 CG14457-PB 24..254 27..256 171 21 Plus
CG7079-PB 255 CG7079-PB 8..246 17..253 166 24.3 Plus
CG7079-PA 255 CG7079-PA 8..246 17..253 166 24.3 Plus
CG2650-PA 260 CG2650-PA 2..256 9..254 159 20.5 Plus
CG17279-PD 245 CG17279-PD 33..241 48..253 158 20.3 Plus
CG31207-PA 258 CG31207-PA 1..245 10..253 150 21.7 Plus
CG16820-PA 309 CG16820-PA 88..307 38..255 148 21.5 Plus
CG5945-PB 250 CG5945-PB 10..248 19..255 146 21.2 Plus
CG5945-PA 250 CG5945-PA 10..248 19..255 146 21.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22504-PA 249 GI22504-PA 1..249 10..258 1212 90 Plus
Dmoj\GI10251-PA 244 GI10251-PA 4..241 16..254 360 29.6 Plus
Dmoj\GI22650-PA 263 GI22650-PA 35..262 29..255 345 30.7 Plus
Dmoj\GI10103-PA 293 GI10103-PA 32..288 5..255 278 25.5 Plus
Dmoj\GI22505-PA 247 GI22505-PA 11..243 19..253 216 23 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22211-PA 249 GL22211-PA 1..249 10..258 1250 93.6 Plus
Dper\GL21627-PA 246 GL21627-PA 4..243 16..254 384 30.3 Plus
Dper\GL12216-PA 269 GL12216-PA 41..268 29..255 318 28.5 Plus
Dper\GL12408-PA 265 GL12408-PA 38..258 32..253 271 25.7 Plus
Dper\GL22212-PA 266 GL22212-PA 6..230 14..237 225 24.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15186-PA 249 GA15186-PA 1..249 10..258 1250 93.6 Plus
Dpse\GA10858-PA 246 GA10858-PA 4..243 16..254 384 30.3 Plus
Dpse\GA10203-PA 269 GA10203-PA 41..268 29..255 317 28.5 Plus
Dpse\GA10301-PA 265 GA10301-PA 38..258 32..253 271 25.7 Plus
Dpse\GA12411-PA 253 GA12411-PA 3..248 6..252 228 25.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10667-PA 249 GM10667-PA 1..249 10..258 1298 97.6 Plus
Dsec\GM10785-PA 246 GM10785-PA 20..243 30..254 376 30.2 Plus
Dsec\GM24280-PA 270 GM24280-PA 42..269 29..255 330 28.9 Plus
Dsec\GM25738-PA 230 GM25738-PA 6..228 32..255 269 25.3 Plus
Dsec\GM17823-PA 246 GM17823-PA 20..244 28..255 195 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19757-PA 246 GD19757-PA 20..243 30..254 376 30.2 Plus
Dsim\GD19070-PA 270 GD19070-PA 42..269 29..255 328 28.9 Plus
Dsim\GD19644-PA 246 GD19644-PA 10..238 18..241 195 23.7 Plus
Dsim\GD21189-PA 250 GD21189-PA 9..245 17..253 191 21.1 Plus
Dsim\GD21191-PA 250 GD21191-PA 20..246 28..253 189 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10107-PA 249 GJ10107-PA 1..249 10..258 1215 90 Plus
Dvir\GJ11056-PA 244 GJ11056-PA 3..241 13..254 359 30.7 Plus
Dvir\GJ23379-PA 264 GJ23379-PA 36..263 29..255 346 30.7 Plus
Dvir\GJ23840-PA 260 GJ23840-PA 33..255 32..255 284 27 Plus
Dvir\GJ23820-PA 254 GJ23820-PA 7..249 14..252 221 24.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14050-PA 251 GK14050-PA 20..251 27..258 1180 94 Plus
Dwil\GK13242-PA 246 GK13242-PA 7..243 17..254 378 29.8 Plus
Dwil\GK13256-PA 268 GK13256-PA 40..267 29..255 331 29.4 Plus
Dwil\GK14019-PA 258 GK14019-PA 31..253 32..255 261 26.2 Plus
Dwil\GK14051-PA 224 GK14051-PA 2..216 32..241 207 26 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25317-PA 249 GE25317-PA 1..249 10..258 1279 97.2 Plus
Dyak\GE25446-PA 246 GE25446-PA 20..243 30..254 375 29.8 Plus
Dyak\GE24362-PA 269 GE24362-PA 41..268 29..255 325 28.9 Plus
Dyak\GE26341-PA 259 GE26341-PA 35..257 32..255 258 24.4 Plus
Dyak\GE23494-PA 251 GE23494-PA 6..246 14..252 218 24.1 Plus