Clone FI16105 Report

Search the DGRC for FI16105

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:161
Well:5
Vector:pOT2
Associated Gene/TranscriptCG14184-RA
Protein status:FI16105.pep: gold
Sequenced Size:638

Clone Sequence Records

FI16105.complete Sequence

638 bp assembled on 2011-11-15

GenBank Submission: BT132777.1

> FI16105.complete
AAAAATAAAGAACAATTGAACAATTGCATTTAGAATGGAGTATGTGCACT
CTGTTTGGAGCTACCTAGCCTCGATCTGCAACTGCTGGCAATGCACCGAA
GATCCAGGTGCGCAGCCCAACGAGCCGAACGAGCGGACACACCTTCTCGT
GGACCCGGTGAACCATAGTCCTGCCCTTCGACGGAGCAACTCCGATGGCC
TCAGCACCGACTACGCCCACTCCCTTCCCAAGAAGGACGATCAGAACGCC
CTCTCCAGACTGGTGCAGAATACTGCGATAAACATGATAAACGTTGGAGC
CATGGACTGTCACAGCCTGGAGCACCAGGAGTACGCCGATAGAATAAGAT
TGTACTCGCAGCGGTTGCATCAACAGTGGAACAACGGCCAGCACGCCAGT
ATCGCACCAAAAGGTCTCCTTAAAGATGTACCAAGCCATCAGTTCTATCT
GTCTAAGCCAACCTATCCAGATGACACTGCTCAAATGAAGCTCTTCACCG
AGAAGGCACACATCAGTGTCTCGCACATACAGATCGACCACAAAGAGGCC
GTGGTTGTTCCCTTCCGGATTCCCTGATTATCGTATCTTAAGTGAAATAA
AGTGATAAATTTATATAAAAAAAAAAAAAAAAAAAAAA

FI16105.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20017959..20018126 279..112 840 100 Minus
chr3L 24539361 chr3L 20017556..20017691 415..280 680 100 Minus
chr3L 24539361 chr3L 20017241..20017372 616..485 630 98.5 Minus
chr3L 24539361 chr3L 20018185..20018299 115..1 575 100 Minus
chr3L 24539361 chr3L 20017424..20017504 488..408 375 97.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20028646..20028813 279..112 840 100 Minus
3L 28110227 3L 20028243..20028378 415..280 680 100 Minus
3L 28110227 3L 20027924..20028059 620..485 680 100 Minus
3L 28110227 3L 20028872..20028986 115..1 575 100 Minus
3L 28110227 3L 20028111..20028191 488..408 375 97.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20021746..20021913 279..112 840 100 Minus
3L 28103327 3L 20021343..20021478 415..280 680 100 Minus
3L 28103327 3L 20021024..20021159 620..485 680 100 Minus
3L 28103327 3L 20021972..20022086 115..1 575 100 Minus
3L 28103327 3L 20021211..20021291 488..408 375 97.5 Minus
Blast to na_te.dros performed on 2019-03-15 11:23:04 has no hits.

FI16105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:24:12 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20017241..20017372 485..616 98 <- Minus
chr3L 20017428..20017498 414..484 100 <- Minus
chr3L 20017558..20017691 280..413 100 <- Minus
chr3L 20017959..20018122 116..279 100 <- Minus
chr3L 20018185..20018299 1..115 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-15 08:51:34 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
CG14184-RB 1..543 35..577 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:42:44 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
CG14184-RA 1..543 35..577 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:31:41 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
CG14184-RA 1..543 35..577 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-15 08:51:33 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
CG14184-RB 53..668 1..616 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:42:44 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
CG14184-RA 35..650 1..616 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:41 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
CG14184-RA 35..650 1..616 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:24:12 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20028872..20028986 1..115 100   Minus
3L 20028245..20028378 280..413 100 <- Minus
3L 20027928..20028059 485..616 100 <- Minus
3L 20028115..20028185 414..484 100 <- Minus
3L 20028646..20028809 116..279 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:24:12 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20028872..20028986 1..115 100   Minus
3L 20028245..20028378 280..413 100 <- Minus
3L 20027928..20028059 485..616 100 <- Minus
3L 20028115..20028185 414..484 100 <- Minus
3L 20028646..20028809 116..279 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:24:12 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20028872..20028986 1..115 100   Minus
3L 20028245..20028378 280..413 100 <- Minus
3L 20027928..20028059 485..616 100 <- Minus
3L 20028115..20028185 414..484 100 <- Minus
3L 20028646..20028809 116..279 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:42:44 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20021028..20021159 485..616 100 <- Minus
arm_3L 20021215..20021285 414..484 100 <- Minus
arm_3L 20021345..20021478 280..413 100 <- Minus
arm_3L 20021746..20021909 116..279 100 <- Minus
arm_3L 20021972..20022086 1..115 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:45 Download gff for FI16105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20021028..20021159 485..616 100 <- Minus
3L 20021215..20021285 414..484 100 <- Minus
3L 20021345..20021478 280..413 100 <- Minus
3L 20021746..20021909 116..279 100 <- Minus
3L 20021972..20022086 1..115 100   Minus

FI16105.hyp Sequence

Translation from 34 to 576

> FI16105.hyp
MEYVHSVWSYLASICNCWQCTEDPGAQPNEPNERTHLLVDPVNHSPALRR
SNSDGLSTDYAHSLPKKDDQNALSRLVQNTAINMINVGAMDCHSLEHQEY
ADRIRLYSQRLHQQWNNGQHASIAPKGLLKDVPSHQFYLSKPTYPDDTAQ
MKLFTEKAHISVSHIQIDHKEAVVVPFRIP*

FI16105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14184-PB 180 CG14184-PB 1..180 1..180 975 100 Plus
CG14184-PA 180 CG14184-PA 1..180 1..180 975 100 Plus

FI16105.pep Sequence

Translation from 34 to 576

> FI16105.pep
MEYVHSVWSYLASICNCWQCTEDPGAQPNEPNERTHLLVDPVNHSPALRR
SNSDGLSTDYAHSLPKKDDQNALSRLVQNTAINMINVGAMDCHSLEHQEY
ADRIRLYSQRLHQQWNNGQHASIAPKGLLKDVPSHQFYLSKPTYPDDTAQ
MKLFTEKAHISVSHIQIDHKEAVVVPFRIP*

FI16105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25216-PA 180 GF25216-PA 1..180 1..180 879 89.4 Plus
Dana\GF19586-PA 180 GF19586-PA 1..180 1..180 854 86.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13350-PA 180 GG13350-PA 1..180 1..180 945 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14384-PA 187 GH14384-PA 1..179 1..180 657 70 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14184-PB 180 CG14184-PB 1..180 1..180 975 100 Plus
CG14184-PA 180 CG14184-PA 1..180 1..180 975 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11328-PA 180 GI11328-PA 1..180 1..180 693 70.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14149-PA 135 GL14149-PA 1..135 1..180 448 54.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12812-PA 99 GA12812-PA 1..99 82..180 418 77.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14533-PA 179 GM14533-PA 1..179 1..180 921 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12229-PA 180 GD12229-PA 1..180 1..180 944 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11584-PA 159 GJ11584-PA 1..151 1..151 566 70.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18423-PA 180 GK18423-PA 1..180 1..180 704 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22936-PA 180 GE22936-PA 1..180 1..180 953 97.2 Plus
Dyak\GE22442-PA 180 GE22442-PA 1..180 1..180 948 96.7 Plus