BDGP Sequence Production Resources |
Search the DGRC for FI16516
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 165 |
Well: | 16 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG5021-RB |
Protein status: | FI16516.pep: gold |
Sequenced Size: | 907 |
907 bp assembled on 2011-12-01
GenBank Submission: BT132854.1
> FI16516.complete CAACAACGTCCCAGGCGAAGAAAATATATTAAATCCCCTGAAAAACCACG AAAATCCATGAAAATTGCACCCAACTAGGAATTAGAAGTCACTCCCTACA CCAGCATGGCATCCGCTACGGTGCCGCTGCTCGACGATGACACGATACCC TTTGGCGAGGAGGACGAGATGCGGGATCCCAGTCGCGCGGGTCAGAAATA CACGCACCCGTACGTCACCTTCTTCCACCTGTTCTTCAGGGGCGCCGCCA TCCTGATCTATATGTTCTGCGGTTGGTTCAGCGACTCCTTCATCACCAGC TTCGTTTTCGTGGTGCTCTTCCTGTCCGCCGACTTCTGGACGGTGAAGAA CATCTCGGGCAGATTGCTGGTGGGTCTCCGCTGGTGGAACTACGTCGACG ACGATGGCGTATCGCACTGGGTGTTTGAGTCAAAGAACAGTCGGGTCAAC AAGAACGAGCAGCGCATCTTCTGGCTGGGACTCATCCTCTGTCCCGTCTT CTGGGGCCTCTTCTTCCTGTTCGCCCTATTCGGCCTGAAGTTCAAATGGC TACTGCTGGTAATGATCGCCATTGCGCTGAATGCCGCCAATCTGTATGGC TACGTCAAGTGTAACTATGGCGCCAATAAGGATCTGAATTCCGCCGCCAC AGACTTTGTGAAAACGCAGTTCTTCAAGAATGCCGTGGACATCATGACAA GGCCCAGTGGCGCCCCACCGCCCACAAATGTACGCCCGACGGGAGTCGTT TGAGCTGGTGGAGACTCCATCTACTAAGTCACCTTGCCACCGTCTGCTGC AGCGCATTCCAAAGAGTATTCGACGCTTCTTCTGGCGCGGACCACGACCT TCGATCGGCATCGCTGTCTGTGTACCATATGTAAAACTTAAAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8959644..8960094 | 439..889 | 2180 | 98.9 | Plus |
chr3L | 24539361 | chr3L | 8959341..8959579 | 200..438 | 1165 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 8958927..8959048 | 1..122 | 610 | 100 | Plus |
chr3L | 24539361 | chr3L | 8959190..8959274 | 120..204 | 425 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8967581..8968033 | 439..891 | 2205 | 99.1 | Plus |
3L | 28110227 | 3L | 8967278..8967516 | 200..438 | 1165 | 99.2 | Plus |
3L | 28110227 | 3L | 8966864..8966985 | 1..122 | 610 | 100 | Plus |
3L | 28110227 | 3L | 8967127..8967211 | 120..204 | 425 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8960681..8961133 | 439..891 | 2205 | 99.1 | Plus |
3L | 28103327 | 3L | 8960378..8960616 | 200..438 | 1165 | 99.1 | Plus |
3L | 28103327 | 3L | 8959964..8960085 | 1..122 | 610 | 100 | Plus |
3L | 28103327 | 3L | 8960227..8960311 | 120..204 | 425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8958927..8959046 | 1..120 | 100 | -> | Plus |
chr3L | 8959191..8959273 | 121..203 | 100 | -> | Plus |
chr3L | 8959345..8959579 | 204..438 | 99 | -> | Plus |
chr3L | 8959644..8960094 | 439..889 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 1..648 | 106..753 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 1..648 | 106..753 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 1..648 | 106..753 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 25..913 | 1..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 36..924 | 1..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5021-RB | 36..924 | 1..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8967282..8967516 | 204..438 | 99 | -> | Plus |
3L | 8967128..8967210 | 121..203 | 100 | -> | Plus |
3L | 8966864..8966983 | 1..120 | 100 | -> | Plus |
3L | 8967581..8968031 | 439..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8967282..8967516 | 204..438 | 99 | -> | Plus |
3L | 8967128..8967210 | 121..203 | 100 | -> | Plus |
3L | 8966864..8966983 | 1..120 | 100 | -> | Plus |
3L | 8967581..8968031 | 439..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8967282..8967516 | 204..438 | 99 | -> | Plus |
3L | 8967128..8967210 | 121..203 | 100 | -> | Plus |
3L | 8966864..8966983 | 1..120 | 100 | -> | Plus |
3L | 8967581..8968031 | 439..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8959964..8960083 | 1..120 | 100 | -> | Plus |
arm_3L | 8960228..8960310 | 121..203 | 100 | -> | Plus |
arm_3L | 8960382..8960616 | 204..438 | 99 | -> | Plus |
arm_3L | 8960681..8961131 | 439..889 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8960382..8960616 | 204..438 | 99 | -> | Plus |
3L | 8960681..8961131 | 439..889 | 99 | Plus | |
3L | 8959964..8960083 | 1..120 | 100 | -> | Plus |
3L | 8960228..8960310 | 121..203 | 100 | -> | Plus |
Translation from 105 to 752
> FI16516.pep MASATVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGAAIL IYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYVDDD GVSHWVFESKNSRVNKNEQRIFWLGLILCPVFWGLFFLFALFGLKFKWLL LVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKNAVDIMTRP SGAPPPTNVRPTGVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24367-PA | 215 | GF24367-PA | 1..215 | 1..215 | 1071 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14361-PA | 215 | GG14361-PA | 1..215 | 1..215 | 1120 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16045-PA | 216 | GH16045-PA | 1..216 | 1..215 | 1058 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5021-PB | 215 | CG5021-PB | 1..215 | 1..215 | 1161 | 100 | Plus |
CG5021-PA | 218 | CG5021-PA | 1..218 | 1..215 | 1147 | 98.6 | Plus |
CG5021-PD | 220 | CG5021-PD | 1..220 | 1..215 | 1145 | 97.7 | Plus |
CG5021-PC | 223 | CG5021-PC | 1..223 | 1..215 | 1131 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12310-PA | 215 | GI12310-PA | 1..215 | 1..215 | 1058 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12488-PA | 215 | GL12488-PA | 1..215 | 1..215 | 1086 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18600-PA | 215 | GA18600-PA | 1..215 | 1..215 | 1086 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25106-PA | 220 | GM25106-PA | 1..220 | 1..215 | 1099 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14141-PA | 232 | GD14141-PA | 20..232 | 8..215 | 1080 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13246-PA | 220 | GJ13246-PA | 1..220 | 1..215 | 983 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16690-PA | 216 | GK16690-PA | 1..216 | 1..215 | 1025 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20793-PA | 215 | GE20793-PA | 1..215 | 1..215 | 1113 | 97.7 | Plus |
Translation from 105 to 752
> FI16516.hyp MASATVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGAAIL IYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYVDDD GVSHWVFESKNSRVNKNEQRIFWLGLILCPVFWGLFFLFALFGLKFKWLL LVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKNAVDIMTRP SGAPPPTNVRPTGVV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5021-PB | 215 | CG5021-PB | 1..215 | 1..215 | 1161 | 100 | Plus |
CG5021-PA | 218 | CG5021-PA | 1..218 | 1..215 | 1147 | 98.6 | Plus |
CG5021-PD | 220 | CG5021-PD | 1..220 | 1..215 | 1145 | 97.7 | Plus |
CG5021-PC | 223 | CG5021-PC | 1..223 | 1..215 | 1131 | 96.4 | Plus |