Clone FI16516 Report

Search the DGRC for FI16516

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:165
Well:16
Vector:pOTB7
Associated Gene/TranscriptCG5021-RB
Protein status:FI16516.pep: gold
Sequenced Size:907

Clone Sequence Records

FI16516.complete Sequence

907 bp assembled on 2011-12-01

GenBank Submission: BT132854.1

> FI16516.complete
CAACAACGTCCCAGGCGAAGAAAATATATTAAATCCCCTGAAAAACCACG
AAAATCCATGAAAATTGCACCCAACTAGGAATTAGAAGTCACTCCCTACA
CCAGCATGGCATCCGCTACGGTGCCGCTGCTCGACGATGACACGATACCC
TTTGGCGAGGAGGACGAGATGCGGGATCCCAGTCGCGCGGGTCAGAAATA
CACGCACCCGTACGTCACCTTCTTCCACCTGTTCTTCAGGGGCGCCGCCA
TCCTGATCTATATGTTCTGCGGTTGGTTCAGCGACTCCTTCATCACCAGC
TTCGTTTTCGTGGTGCTCTTCCTGTCCGCCGACTTCTGGACGGTGAAGAA
CATCTCGGGCAGATTGCTGGTGGGTCTCCGCTGGTGGAACTACGTCGACG
ACGATGGCGTATCGCACTGGGTGTTTGAGTCAAAGAACAGTCGGGTCAAC
AAGAACGAGCAGCGCATCTTCTGGCTGGGACTCATCCTCTGTCCCGTCTT
CTGGGGCCTCTTCTTCCTGTTCGCCCTATTCGGCCTGAAGTTCAAATGGC
TACTGCTGGTAATGATCGCCATTGCGCTGAATGCCGCCAATCTGTATGGC
TACGTCAAGTGTAACTATGGCGCCAATAAGGATCTGAATTCCGCCGCCAC
AGACTTTGTGAAAACGCAGTTCTTCAAGAATGCCGTGGACATCATGACAA
GGCCCAGTGGCGCCCCACCGCCCACAAATGTACGCCCGACGGGAGTCGTT
TGAGCTGGTGGAGACTCCATCTACTAAGTCACCTTGCCACCGTCTGCTGC
AGCGCATTCCAAAGAGTATTCGACGCTTCTTCTGGCGCGGACCACGACCT
TCGATCGGCATCGCTGTCTGTGTACCATATGTAAAACTTAAAAAAAAAAA
AAAAAAA

FI16516.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8959644..8960094 439..889 2180 98.9 Plus
chr3L 24539361 chr3L 8959341..8959579 200..438 1165 99.2 Plus
chr3L 24539361 chr3L 8958927..8959048 1..122 610 100 Plus
chr3L 24539361 chr3L 8959190..8959274 120..204 425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8967581..8968033 439..891 2205 99.1 Plus
3L 28110227 3L 8967278..8967516 200..438 1165 99.2 Plus
3L 28110227 3L 8966864..8966985 1..122 610 100 Plus
3L 28110227 3L 8967127..8967211 120..204 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8960681..8961133 439..891 2205 99.1 Plus
3L 28103327 3L 8960378..8960616 200..438 1165 99.1 Plus
3L 28103327 3L 8959964..8960085 1..122 610 100 Plus
3L 28103327 3L 8960227..8960311 120..204 425 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:47:09 has no hits.

FI16516.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:48:02 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8958927..8959046 1..120 100 -> Plus
chr3L 8959191..8959273 121..203 100 -> Plus
chr3L 8959345..8959579 204..438 99 -> Plus
chr3L 8959644..8960094 439..889 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 12:29:09 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 1..648 106..753 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:40 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 1..648 106..753 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:42:39 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 1..648 106..753 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 12:29:08 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 25..913 1..889 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:40 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 36..924 1..889 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:42:39 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG5021-RB 36..924 1..889 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:02 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8967282..8967516 204..438 99 -> Plus
3L 8967128..8967210 121..203 100 -> Plus
3L 8966864..8966983 1..120 100 -> Plus
3L 8967581..8968031 439..889 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:02 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8967282..8967516 204..438 99 -> Plus
3L 8967128..8967210 121..203 100 -> Plus
3L 8966864..8966983 1..120 100 -> Plus
3L 8967581..8968031 439..889 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:02 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8967282..8967516 204..438 99 -> Plus
3L 8967128..8967210 121..203 100 -> Plus
3L 8966864..8966983 1..120 100 -> Plus
3L 8967581..8968031 439..889 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:40 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8959964..8960083 1..120 100 -> Plus
arm_3L 8960228..8960310 121..203 100 -> Plus
arm_3L 8960382..8960616 204..438 99 -> Plus
arm_3L 8960681..8961131 439..889 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:04 Download gff for FI16516.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8960382..8960616 204..438 99 -> Plus
3L 8960681..8961131 439..889 99   Plus
3L 8959964..8960083 1..120 100 -> Plus
3L 8960228..8960310 121..203 100 -> Plus

FI16516.pep Sequence

Translation from 105 to 752

> FI16516.pep
MASATVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGAAIL
IYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYVDDD
GVSHWVFESKNSRVNKNEQRIFWLGLILCPVFWGLFFLFALFGLKFKWLL
LVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKNAVDIMTRP
SGAPPPTNVRPTGVV*

FI16516.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24367-PA 215 GF24367-PA 1..215 1..215 1071 93 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14361-PA 215 GG14361-PA 1..215 1..215 1120 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16045-PA 216 GH16045-PA 1..216 1..215 1058 91.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5021-PB 215 CG5021-PB 1..215 1..215 1161 100 Plus
CG5021-PA 218 CG5021-PA 1..218 1..215 1147 98.6 Plus
CG5021-PD 220 CG5021-PD 1..220 1..215 1145 97.7 Plus
CG5021-PC 223 CG5021-PC 1..223 1..215 1131 96.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12310-PA 215 GI12310-PA 1..215 1..215 1058 91.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12488-PA 215 GL12488-PA 1..215 1..215 1086 94 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18600-PA 215 GA18600-PA 1..215 1..215 1086 94 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25106-PA 220 GM25106-PA 1..220 1..215 1099 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14141-PA 232 GD14141-PA 20..232 8..215 1080 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13246-PA 220 GJ13246-PA 1..220 1..215 983 91.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16690-PA 216 GK16690-PA 1..216 1..215 1025 89.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20793-PA 215 GE20793-PA 1..215 1..215 1113 97.7 Plus

FI16516.hyp Sequence

Translation from 105 to 752

> FI16516.hyp
MASATVPLLDDDTIPFGEEDEMRDPSRAGQKYTHPYVTFFHLFFRGAAIL
IYMFCGWFSDSFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYVDDD
GVSHWVFESKNSRVNKNEQRIFWLGLILCPVFWGLFFLFALFGLKFKWLL
LVMIAIALNAANLYGYVKCNYGANKDLNSAATDFVKTQFFKNAVDIMTRP
SGAPPPTNVRPTGVV*

FI16516.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5021-PB 215 CG5021-PB 1..215 1..215 1161 100 Plus
CG5021-PA 218 CG5021-PA 1..218 1..215 1147 98.6 Plus
CG5021-PD 220 CG5021-PD 1..220 1..215 1145 97.7 Plus
CG5021-PC 223 CG5021-PC 1..223 1..215 1131 96.4 Plus