Clone FI16602 Report

Search the DGRC for FI16602

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:2
Vector:pOT2
Associated Gene/TranscriptCG13559-RA
Protein status:FI16602.pep: gold
Sequenced Size:609

Clone Sequence Records

FI16602.complete Sequence

609 bp assembled on 2011-12-01

GenBank Submission: BT132866.1

> FI16602.complete
CAAGAACTCACATTAAGTGAAGCTAAGACCTGGAATAAGTGTATACAAAG
TGTTCCTGTAAAATCCTGTAAAAGAGTACAAAGACTTATAAATAAATAGG
ATGAGTTCCTTCGCCCGGGTTCCCAGCACACCTCCTCCTTCGTATGAGGA
GGCAATGGGCTGGGAAACACGGAGATCACACAGCACCACGTGGCTGCTCG
CGGAGAATACCTCATCACTCATGATCTGTCCAATGTGCCATGACGAGATC
GAGACGACCACAAAGATCCGGCGCCGCTGGATCGCCTACGTGGCCTCGGG
CATAGTCTTGTTCACCACCTGCGGCATTGGATGCTGGCTAATCCCCTGCA
TCCTCGACTGTTTCAACGAGATCCATCACTCGTGTCCCGTCTGCAAGGCG
ACCCTGGGAATCGTTCCGCAGCAGGATCAGAGGTGGCCAACCTAATTTAA
AGTGCACAAAATGAGCTTAAAGCTTTATTATTTAATACCTAAAACTAAGT
GGATGCCACAAGCTGAAAAAAAGAATTGTAGCTCTAAGTTAATACAGAGT
TGTACTGAATAAACCTAAAATCAATACGTTAAACGCAAAAAAAAAAAAAA
AAAAAAAAA

FI16602.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19389556..19390141 1..586 2930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23503230..23503816 1..587 2935 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23504429..23505015 1..587 2935 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:50:05 has no hits.

FI16602.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:51:14 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19389556..19390141 1..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 12:59:42 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 1..345 101..445 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:04 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 1..345 101..445 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:43:18 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 1..345 101..445 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 12:59:41 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 1..345 101..445 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:04 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 285..870 1..586 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:43:18 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 285..870 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:14 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23503230..23503815 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:14 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23503230..23503815 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:14 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23503230..23503815 1..586 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:04 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19390753..19391338 1..586 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:17 Download gff for FI16602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23504447..23505032 1..586 100   Plus

FI16602.pep Sequence

Translation from 100 to 444

> FI16602.pep
MSSFARVPSTPPPSYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEI
ETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKA
TLGIVPQQDQRWPT*

FI16602.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24273-PA 125 GF24273-PA 17..121 8..103 192 41 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22861-PA 113 GG22861-PA 1..113 1..114 431 71.1 Plus
Dere\GG14910-PA 130 GG14910-PA 16..126 8..103 192 39.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15394-PA 129 GH15394-PA 16..125 8..103 184 39.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13559-PA 114 CG13559-PA 1..114 1..114 641 100 Plus
CG32280-PD 130 CG32280-PD 16..126 8..103 211 39.6 Plus
CG32280-PC 130 CG32280-PC 16..126 8..103 211 39.6 Plus
CG32280-PB 130 CG32280-PB 16..126 8..103 211 39.6 Plus
CG32280-PA 130 CG32280-PA 16..126 8..103 211 39.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13000-PA 130 GI13000-PA 16..126 8..103 181 38.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21680-PA 131 GL21680-PA 17..127 8..103 193 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16808-PA 131 GA16808-PA 17..127 8..103 193 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16019-PA 114 GM16019-PA 1..114 1..114 526 87.7 Plus
Dsec\GM14539-PA 130 GM14539-PA 16..126 8..103 184 38.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13732-PA 130 GD13732-PA 16..126 8..103 184 38.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13143-PA 129 GJ13143-PA 16..125 8..103 182 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17763-PA 131 GK17763-PA 17..127 8..103 192 38.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14296-PA 114 GE14296-PA 1..114 1..114 494 82.5 Plus
Dyak\GE20364-PA 130 GE20364-PA 16..126 8..103 192 39.6 Plus

FI16602.hyp Sequence

Translation from 100 to 444

> FI16602.hyp
MSSFARVPSTPPPSYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEI
ETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKA
TLGIVPQQDQRWPT*

FI16602.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13559-PA 114 CG13559-PA 1..114 1..114 641 100 Plus
CG32280-PD 130 CG32280-PD 16..126 8..103 211 39.6 Plus
CG32280-PC 130 CG32280-PC 16..126 8..103 211 39.6 Plus
CG32280-PB 130 CG32280-PB 16..126 8..103 211 39.6 Plus
CG32280-PA 130 CG32280-PA 16..126 8..103 211 39.6 Plus