Clone FI16603 Report

Search the DGRC for FI16603

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:3
Vector:pOT2
Associated Gene/TranscriptCG8401-RB
Protein status:FI16603.pep: gold
Sequenced Size:1074

Clone Sequence Records

FI16603.complete Sequence

1074 bp assembled on 2011-12-01

GenBank Submission: BT132856.1

> FI16603.complete
GACAACATGTTGCTCTTGGGCCTGAAATACGCTCTTCTACTGGCCATTAC
CGGCTGTTTCCTGGTGCCAATCCATGGATCAGGATCGGATACTGACCAGG
TCCTGCCGCACCGCATCTACCGTCTGCTGGACCGCCTCTCCGGAGGACGC
CGCCTGAGTGCCAGCTCTACATTCGCCCTGTTGCTCTCGCAGTTTCTGAT
AAAACAGAAACTGCGTTACGTGGCGCCTACGCGTTACGAACGTCAGCTCT
ACTACCATCTGCTGCACAGGATGGAACACATCAGAAGGGGATCGGGTCTG
GTTTCCAGGGAGCATGGTGTCCAGGGGGAGATTCTCAGCATTGCCTTTCA
GGCGAATGTGTTGCTGCTGCCTCCCTCGCTGAAACTGGGCGAACTGAATG
CCAATGGGGAGTACGAGCAGCTGGCCGAGGTCTACCCGAAAGTGGTCAAC
GAGGGCCAGCTGAACAGGACGCAGTCCGACCTCTGCCTCCGGGACATTGT
GGAACTGAAGCCACCCCACTGCAAGCTGCTCTCCGGCGAATGTTTGGAAC
TTTTGGCCAGTGATGCACCAGCCTACGGATACCAGAGAACCCATCAGGTC
CTGCTGCTCTACGTGCTGGAGCATCAGGCATGTGCCCCCCACCTCAGCCC
ACCTCAGGTTTACGAACTGCTGGCCAAGAGTCAGTGCGATGAGGTGGAAC
GCGAGCAGAACGCCATCCGGAGCCTGGGGCTGCCAGTCGTGTATCGCGAT
CTGTATCTGGAGCAAGCCACCATCTGCGGCCTGTTTGGCTACAATGAGTT
TGTCAACTGGCGCAACGTAATGGAAATTGGCAGCTGGCTGGAGGGGGACT
CGCCGAAGGATATGGATGTATTGGCTGACGACGGCGATAGCCAGCACATA
AGCGATTTGGCCTTGGTCTTCTACACAAATGCACTGCTGCTGCTGCACTA
ATCCATCGAACATTCCCCCAATACCAAGCCCATCCATAATTTCTGCTTCT
GCTTGATAAGTTAATAAAGTGGCGCTTATTGCTTTATGGTTGTGTCGATT
TCAGCAAAAAAAAAAAAAAAAAAA

FI16603.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11917070..11917360 765..1055 1455 100 Plus
chr2R 21145070 chr2R 11915870..11916074 1..205 1025 100 Plus
chr2R 21145070 chr2R 11916760..11916929 597..766 850 100 Plus
chr2R 21145070 chr2R 11916330..11916476 332..478 735 100 Plus
chr2R 21145070 chr2R 11916149..11916274 206..331 630 100 Plus
chr2R 21145070 chr2R 11916576..11916695 478..597 600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16029801..16030093 765..1057 1465 100 Plus
2R 25286936 2R 16028601..16028805 1..205 1025 100 Plus
2R 25286936 2R 16029491..16029660 597..766 850 100 Plus
2R 25286936 2R 16029061..16029207 332..478 735 100 Plus
2R 25286936 2R 16028880..16029005 206..331 630 100 Plus
2R 25286936 2R 16029307..16029426 478..597 600 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16031000..16031292 765..1057 1465 100 Plus
2R 25260384 2R 16029800..16030004 1..205 1025 100 Plus
2R 25260384 2R 16030690..16030859 597..766 850 100 Plus
2R 25260384 2R 16030260..16030406 332..478 735 100 Plus
2R 25260384 2R 16030079..16030204 206..331 630 100 Plus
2R 25260384 2R 16030506..16030625 478..597 600 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:51:08 has no hits.

FI16603.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:51:47 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11916577..11916694 479..596 100 -> Plus
chr2R 11916760..11916929 597..766 100 -> Plus
chr2R 11917072..11917360 767..1055 100   Plus
chr2R 11916330..11916476 332..478 100 -> Plus
chr2R 11915870..11916074 1..205 100 -> Plus
chr2R 11916149..11916274 206..331 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 16:27:28 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
CG8401-RB 1..945 7..951 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:44 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
CG8401-RB 1..945 7..951 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:44:26 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
CG8401-RB 1..945 7..951 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 16:27:28 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
CG8401-RB 1..1053 3..1055 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:44 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
CG8401-RB 1..1053 3..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:44:26 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
CG8401-RB 1..1053 3..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:47 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16028601..16028805 1..205 100 -> Plus
2R 16028880..16029005 206..331 100 -> Plus
2R 16029061..16029207 332..478 100 -> Plus
2R 16029308..16029425 479..596 100 -> Plus
2R 16029491..16029660 597..766 100 -> Plus
2R 16029803..16030091 767..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:47 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16028601..16028805 1..205 100 -> Plus
2R 16028880..16029005 206..331 100 -> Plus
2R 16029061..16029207 332..478 100 -> Plus
2R 16029308..16029425 479..596 100 -> Plus
2R 16029491..16029660 597..766 100 -> Plus
2R 16029803..16030091 767..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:47 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16028601..16028805 1..205 100 -> Plus
2R 16028880..16029005 206..331 100 -> Plus
2R 16029061..16029207 332..478 100 -> Plus
2R 16029308..16029425 479..596 100 -> Plus
2R 16029491..16029660 597..766 100 -> Plus
2R 16029803..16030091 767..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:44 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11916566..11916712 332..478 100 -> Plus
arm_2R 11916813..11916930 479..596 100 -> Plus
arm_2R 11916996..11917165 597..766 100 -> Plus
arm_2R 11917308..11917596 767..1055 100   Plus
arm_2R 11916106..11916310 1..205 100 -> Plus
arm_2R 11916385..11916510 206..331 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:34 Download gff for FI16603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16031002..16031290 767..1055 100   Plus
2R 16030079..16030204 206..331 100 -> Plus
2R 16030260..16030406 332..478 100 -> Plus
2R 16030507..16030624 479..596 100 -> Plus
2R 16030690..16030859 597..766 100 -> Plus
2R 16029800..16030004 1..205 100 -> Plus

FI16603.pep Sequence

Translation from 0 to 950

> FI16603.pep
DNMLLLGLKYALLLAITGCFLVPIHGSGSDTDQVLPHRIYRLLDRLSGGR
RLSASSTFALLLSQFLIKQKLRYVAPTRYERQLYYHLLHRMEHIRRGSGL
VSREHGVQGEILSIAFQANVLLLPPSLKLGELNANGEYEQLAEVYPKVVN
EGQLNRTQSDLCLRDIVELKPPHCKLLSGECLELLASDAPAYGYQRTHQV
LLLYVLEHQACAPHLSPPQVYELLAKSQCDEVEREQNAIRSLGLPVVYRD
LYLEQATICGLFGYNEFVNWRNVMEIGSWLEGDSPKDMDVLADDGDSQHI
SDLALVFYTNALLLLH*

FI16603.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11286-PA 301 GF11286-PA 1..301 3..316 1090 70.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20561-PA 315 GG20561-PA 1..315 3..316 1509 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22062-PA 316 GH22062-PA 38..316 27..316 919 62.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG8401-PB 314 CG8401-PB 1..314 3..316 1627 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19147-PA 322 GI19147-PA 15..322 11..316 860 58.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17210-PA 319 GL17210-PA 1..319 3..316 1063 67.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21049-PA 319 GA21049-PA 1..319 3..316 1082 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21653-PA 314 GM21653-PA 1..314 3..316 1571 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11153-PA 314 GD11153-PA 1..314 3..316 1581 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22280-PA 302 GJ22280-PA 1..301 4..315 858 59.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11747-PA 309 GE11747-PA 1..309 3..316 1438 91.7 Plus

FI16603.hyp Sequence

Translation from 0 to 950

> FI16603.hyp
DNMLLLGLKYALLLAITGCFLVPIHGSGSDTDQVLPHRIYRLLDRLSGGR
RLSASSTFALLLSQFLIKQKLRYVAPTRYERQLYYHLLHRMEHIRRGSGL
VSREHGVQGEILSIAFQANVLLLPPSLKLGELNANGEYEQLAEVYPKVVN
EGQLNRTQSDLCLRDIVELKPPHCKLLSGECLELLASDAPAYGYQRTHQV
LLLYVLEHQACAPHLSPPQVYELLAKSQCDEVEREQNAIRSLGLPVVYRD
LYLEQATICGLFGYNEFVNWRNVMEIGSWLEGDSPKDMDVLADDGDSQHI
SDLALVFYTNALLLLH*

FI16603.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8401-PB 314 CG8401-PB 1..314 3..316 1627 100 Plus