Clone FI16614 Report

Search the DGRC for FI16614

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:14
Vector:pOT2
Associated Gene/TranscriptCG14036-RA
Protein status:FI16614.pep: gold
Sequenced Size:446

Clone Sequence Records

FI16614.complete Sequence

446 bp assembled on 2011-12-02

GenBank Submission: BT132873.1

> FI16614.complete
CTTAAGCTTTATGAATTTGTTGTTTTGACAAACGGCTCTTGACTTTTTCA
AAATGTCCGATTTCGAGTACGGAATTTGCCCTTACGACAAATCGCACCGC
ATCTTGCTCTTCCGGATGCCCAAGCACTTAATTAAGTGCGAGAAGAACTA
CTGTGGACCGCCGCTGCAGACCTGCAAGTACAACGCCACACACCGAGTCC
AGGACATGGAGAAGCATCTGAAGGAGTGTGACTACTATCTCCGCAGCATC
GAAAACCAGGCGGTGCAGATAGCGCTTCGTAGTCGCATACCGCCCAAACA
GGAAGATGGACATGATGTGGACACACCATTTTAGGCTAAGACAAGCAGGC
ATCCAAATATACCATGTACATATGTGATAGTATATGAACCATAAAATAAA
AAGCTTCTTGAAGAAGCATGCACAATAAAAAAAAAAAAAAAAAAAA

FI16614.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5053679..5054104 426..1 2130 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5054578..5055004 427..1 2135 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5054578..5055004 427..1 2135 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:55:39 has no hits.

FI16614.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:56:44 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5053679..5054104 1..426 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 15:53:19 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 1..282 53..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:36 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 1..282 53..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:46:05 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 1..282 53..334 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 15:53:19 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 1..426 1..426 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:36 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 13..438 1..426 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:46:05 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 13..438 1..426 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:44 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5054579..5055004 1..426 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:44 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5054579..5055004 1..426 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:44 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5054579..5055004 1..426 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:36 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5054579..5055004 1..426 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:56 Download gff for FI16614.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5054579..5055004 1..426 100   Minus

FI16614.hyp Sequence

Translation from 52 to 333

> FI16614.hyp
MSDFEYGICPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNATHRVQ
DMEKHLKECDYYLRSIENQAVQIALRSRIPPKQEDGHDVDTPF*

FI16614.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-PA 93 CG14036-PA 1..93 1..93 519 100 Plus
CG32625-PA 144 CG32625-PA 8..70 4..64 137 41.3 Plus

FI16614.pep Sequence

Translation from 52 to 333

> FI16614.pep
MSDFEYGICPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNATHRVQ
DMEKHLKECDYYLRSIENQAVQIALRSRIPPKQEDGHDVDTPF*

FI16614.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14157-PA 93 GF14157-PA 1..91 1..91 320 63.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24320-PA 93 GG24320-PA 1..93 1..93 399 77.4 Plus
Dere\GG19487-PA 147 GG19487-PA 9..65 5..59 138 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10268-PA 86 GH10268-PA 1..83 1..81 243 56.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-PA 93 CG14036-PA 1..93 1..93 519 100 Plus
CG32625-PA 144 CG32625-PA 8..70 4..64 137 41.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15649-PA 87 GI15649-PA 1..87 1..84 249 58.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26476-PA 94 GL26476-PA 1..70 1..70 261 62.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12717-PA 94 GA12717-PA 1..70 1..70 264 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18039-PA 93 GM18039-PA 1..93 1..93 438 89.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22665-PA 93 GD22665-PA 1..93 1..93 435 88.2 Plus
Dsim\GD23063-PA 144 GD23063-PA 10..67 8..63 131 46.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10122-PA 88 GJ10122-PA 1..87 1..84 254 56.3 Plus
Dvir\GJ19312-PA 164 GJ19312-PA 25..85 3..61 130 39.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19076-PA 86 GK19076-PA 1..85 1..85 238 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18700-PA 93 GE18700-PA 5..93 5..93 403 82 Plus
Dyak\GE16140-PA 147 GE16140-PA 9..65 5..59 144 49.1 Plus