Clone FI16617 Report

Search the DGRC for FI16617

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:17
Vector:pOT2
Associated Gene/TranscriptCG13749-RB
Protein status:FI16617.pep: gold
Sequenced Size:919

Clone Sequence Records

FI16617.complete Sequence

919 bp assembled on 2011-12-02

GenBank Submission: BT132875.1

> FI16617.complete
TGACAATGCATTTGCTTGGACTTCTCGTGCCGATCGCTTGCGCTGTTTTG
TGCGTTGGTGAAAAATCCCTTTACCATGGTCTCGCCCAAACGGAGACTAA
TCGACGATTCCATTGCTCCCTCAGCTGCCGATCTCCAGCGGACATACGAC
GGACATGATGGGCCTCACGTTTTCGGAACACCCGGCAATCAAGTCTACAT
TCGGGGGCAGAACGATGGCGTATACAAGGTGCCAGGAGTAGGTGGTCAGT
TCCATCACGCATCGTCGCCAGCAGATCACGTCTATACGGATGAGCAGGGG
ATCACGTATGTGCACAAAAAAGACGCTGGAGGACCAGGAACACATACGCT
TAGAGGACCAGGTCTAGCTGCTGTACAGCCCGCCTACTCCACTGTGCAGC
CTGCGGGACTTCGCAATCCCCAGTTTCATGTGGAGCGAAGTGGTCGCACT
GTGGATGTTGGTTCTGGAGGATTTGTCGTCCAAAGGAGCAGACGTAGTCC
TCAGTTCCATGTGGAGCGTCCTGGTCGCACTGTGGATGTGGGTTCCGGAG
GATTTTTTGTCCAAAGGGGCAGGCGTAGTCCCCAGTTTCCTGTGGAGCGA
CCTTGGCAAAGGGCTTTGAAGGACTGATTGTTGAAAGGGACAGCCGCAGC
ATCAAAGATGGCCGCGTCCAGGGAGAAAACTTCGTGGCTCGTGACGATCA
AGCAGGAATTTGGGATGATAGTGTGTCGGTGTGGAAGCGTCCGGATGGAC
GAACTGTCTCGGTGGGCAATGACGGAAGTGTTATTGTTTCTGGACATGGG
CACACGCTGCAATACTAATAAATAATGGGAAGCAGCCTTTTAATTTACAG
AGATTAGGTAGCTAAAATTCCAATGATATTAAATGAACAAGATTCACAAA
AAAAAAAAAAAAAAAAAAA

FI16617.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4821368..4821854 336..812 2250 97.9 Plus
chr2R 21145070 chr2R 4820974..4821311 1..338 1690 100 Plus
chr2R 21145070 chr2R 4821917..4822006 808..897 435 98.9 Plus
chr2R 21145070 chr2R 4821530..4821635 417..522 305 85.8 Plus
chr2R 21145070 chr2R 4821449..4821554 498..603 305 85.8 Plus
chr2R 21145070 chr2R 9295125..9295232 651..758 300 85.2 Plus
chr2R 21145070 chr2R 9299852..9299959 651..758 300 85.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8933817..8934293 336..812 2385 100 Plus
2R 25286936 2R 8933423..8933760 1..338 1690 100 Plus
2R 25286936 2R 8934356..8934450 808..902 460 98.9 Plus
2R 25286936 2R 8933898..8934003 498..603 305 85.8 Plus
2R 25286936 2R 8933979..8934084 417..522 305 85.8 Plus
2R 25286936 2R 13407778..13407885 651..758 300 85.2 Plus
2R 25286936 2R 13412505..13412612 651..758 300 85.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8935016..8935492 336..812 2385 100 Plus
2R 25260384 2R 8934622..8934959 1..338 1690 100 Plus
2R 25260384 2R 8935555..8935649 808..902 460 98.9 Plus
2R 25260384 2R 13413704..13413811 651..758 300 85.1 Plus
2R 25260384 2R 13408977..13409084 651..758 300 85.1 Plus
2R 25260384 2R 13413615..13413661 491..537 145 87.2 Plus
2R 25260384 2R 13408888..13408934 491..537 145 87.2 Plus
Blast to na_te.dros performed on 2019-03-15 11:53:56 has no hits.

FI16617.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:55:02 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4820974..4821310 1..337 100 -> Plus
chr2R 4821370..4821854 338..812 97 -> Plus
chr2R 4821922..4822006 813..897 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 08:45:34 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
CG13749-RB 1..552 76..627 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:54 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
CG13749-RB 1..552 76..627 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:44:47 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
CG13749-RB 1..552 76..627 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 08:45:33 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
CG13749-RB 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:54 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
CG13749-RB 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:44:47 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
CG13749-RB 1..897 1..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:02 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8933423..8933759 1..337 100 -> Plus
2R 8933819..8934293 338..812 100 -> Plus
2R 8934361..8934445 813..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:02 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8933423..8933759 1..337 100 -> Plus
2R 8933819..8934293 338..812 100 -> Plus
2R 8934361..8934445 813..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:02 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8933423..8933759 1..337 100 -> Plus
2R 8933819..8934293 338..812 100 -> Plus
2R 8934361..8934445 813..897 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:54 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4820928..4821264 1..337 100 -> Plus
arm_2R 4821324..4821798 338..812 100 -> Plus
arm_2R 4821866..4821950 813..897 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:40 Download gff for FI16617.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8934622..8934958 1..337 100 -> Plus
2R 8935018..8935492 338..812 100 -> Plus
2R 8935560..8935644 813..897 100   Plus

FI16617.hyp Sequence

Translation from 75 to 626

> FI16617.hyp
MVSPKRRLIDDSIAPSAADLQRTYDGHDGPHVFGTPGNQVYIRGQNDGVY
KVPGVGGQFHHASSPADHVYTDEQGITYVHKKDAGGPGTHTLRGPGLAAV
QPAYSTVQPAGLRNPQFHVERSGRTVDVGSGGFVVQRSRRSPQFHVERPG
RTVDVGSGGFFVQRGRRSPQFPVERPWQRALKD*

FI16617.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13749-PB 183 CG13749-PB 1..183 1..183 987 100 Plus
CG33470-PC 257 CG33470-PC 18..182 17..176 557 61.8 Plus
CG33470-PA 257 CG33470-PA 18..182 17..176 557 61.8 Plus
IM10-PC 257 CG18279-PC 18..182 17..176 557 61.8 Plus
IM10-PA 257 CG18279-PA 18..182 17..176 557 61.8 Plus

FI16617.pep Sequence

Translation from 75 to 626

> FI16617.pep
MVSPKRRLIDDSIAPSAADLQRTYDGHDGPHVFGTPGNQVYIRGQNDGVY
KVPGVGGQFHHASSPADHVYTDEQGITYVHKKDAGGPGTHTLRGPGLAAV
QPAYSTVQPAGLRNPQFHVERSGRTVDVGSGGFVVQRSRRSPQFHVERPG
RTVDVGSGGFFVQRGRRSPQFPVERPWQRALKD*

FI16617.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12218-PA 228 GF12218-PA 9..172 8..168 498 63.1 Plus
Dana\GF13690-PA 259 GF13690-PA 18..185 17..176 461 58.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20379-PA 257 GG20379-PA 9..182 8..176 527 60.9 Plus
Dere\GG20752-PA 112 GG20752-PA 9..85 8..84 185 46.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23113-PA 360 GH23113-PA 75..230 16..169 347 55.1 Plus
Dgri\GH23113-PA 360 GH23113-PA 2..73 16..87 231 63.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13749-PB 183 CG13749-PB 1..183 1..183 987 100 Plus
IMPPP-PC 257 CG18279-PC 18..182 17..176 557 61.8 Plus
IMPPP-PA 257 CG18279-PA 18..182 17..176 557 61.8 Plus
CG33470-PC 257 CG33470-PC 18..182 17..176 557 61.8 Plus
CG33470-PA 257 CG33470-PA 18..182 17..176 557 61.8 Plus
CG30285-PA 112 CG30285-PA 17..85 16..84 214 53.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18936-PA 241 GI18936-PA 9..161 21..182 262 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11683-PA 305 GL11683-PA 18..188 17..176 545 66.1 Plus
Dper\GL11270-PA 112 GL11270-PA 9..86 8..86 175 46.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24235-PA 278 GA24235-PA 18..179 17..167 508 64.8 Plus
Dpse\GA15751-PA 112 GA15751-PA 9..86 8..86 191 49.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21080-PA 272 GM21080-PA 36..199 13..176 704 86 Plus
Dsec\GM21466-PA 257 GM21466-PA 18..182 17..176 524 61.8 Plus
Dsec\GM15695-PA 112 GM15695-PA 9..83 8..82 215 53.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10615-PA 245 GD10615-PA 39..190 17..168 620 80.3 Plus
Dsim\GD10965-PA 268 GD10965-PA 19..182 18..176 526 62.2 Plus
Dsim\GD25174-PA 112 GD25174-PA 9..85 8..84 213 51.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21308-PA 269 GJ21308-PA 1..211 13..170 352 44.5 Plus
Dvir\GJ21309-PA 351 GJ21309-PA 1..207 17..170 298 41.1 Plus
Dvir\GJ21309-PA 351 GJ21309-PA 264..335 12..83 198 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10648-PA 346 GK10648-PA 21..211 21..176 334 43.8 Plus
Dwil\GK10645-PA 175 GK10645-PA 12..156 13..148 247 45 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12540-PA 259 GE12540-PA 18..184 17..176 486 60.5 Plus
Dyak\GE19241-PA 251 GE19241-PA 13..183 12..172 386 51.5 Plus
Dyak\GE13684-PA 119 GE13684-PA 13..89 12..91 196 51.2 Plus