Clone FI16619 Report

Search the DGRC for FI16619

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:19
Vector:pOT2
Associated Gene/TranscriptCG4325-RA
Protein status:FI16619.pep: gold
Sequenced Size:594

Clone Sequence Records

FI16619.complete Sequence

594 bp assembled on 2011-12-01

GenBank Submission: BT132862.1

> FI16619.complete
AGCAACAATACGGCACAGGGAGATCGAACCTGATTGGATCGGAGCGAATC
GAATCGACCTAGGTATAAGTCAACCGGAGCGGAATGGGCCGTAACAACGT
CATCTGCACGATCTGCTCGGAGCGGTTTCGCACCTCGGACAATATACAAG
CCGGCAGCTGCGGACACGCGTTCCACGAGGACTGCCTAGACCACTGGAGA
AAGCAATCAAGGACTTGCCCTATCTGCCGCAGCCAGGATGCCGCCTACTT
TCAGCTTTATCTGGACTTTGAGGAGTTTCCGGAAAGTGCATCGGCTCAGG
GTGGCAGTTGGGGCGGCCATAATCGGAGCCAAGGTCACAGCAGCAGCAGC
AGCAGCTGCAGCAGCAACAACAACAACAGTAACGACAACAGCAGCAGTGA
CGATTATATTGGAATTATGAGGGAGTACGAGAATCTACTTTACGAGACGG
GCGTGTACCGAGAAGAGATCGAATATCTTAACCAGCGGATCGGAGCCCTT
ACTGTCCTCAATGCTGAACTCAGCAAACTACATGAATGTTCGGATTCGGA
TGTTGATTAAAAGCCGTAAACAAACAAAAAAAAAAAAAAAAAAA

FI16619.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1936954..1937323 575..206 1850 100 Minus
chrX 22417052 chrX 1937516..1937720 205..1 1025 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2043041..2043413 578..206 1865 100 Minus
X 23542271 X 2043606..2043810 205..1 1025 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2051139..2051511 578..206 1865 100 Minus
X 23527363 X 2051704..2051908 205..1 1025 100 Minus
X 23527363 X 4091311..4091369 338..396 205 89.8 Plus
X 23527363 X 4092135..4092194 337..396 195 88.3 Plus
2R 25260384 2R 11209585..11209640 338..393 190 89.2 Plus
X 23527363 X 8408508..8408550 337..379 185 95.3 Plus
3R 31820162 3R 30101608..30101665 340..397 185 87.9 Plus
Blast to na_te.dros performed on 2019-03-15 11:47:33 has no hits.

FI16619.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:48:14 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1937192..1937323 206..337 100 <- Minus
chrX 1937516..1937720 1..205 100   Minus
chrX 1936954..1937125 404..575 100 == Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 12:47:30 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
CG4325-RA 1..477 84..560 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:56 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
CG4325-RA 1..477 84..560 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:43:05 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
CG4325-RA 1..477 84..560 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 12:47:30 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
CG4325-RA 9..583 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:56 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
CG4325-RA 9..583 1..575 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:43:05 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
CG4325-RA 9..583 1..575 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:14 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
X 2043044..2043413 206..575 100 <- Minus
X 2043606..2043810 1..205 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:14 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
X 2043044..2043413 206..575 100 <- Minus
X 2043606..2043810 1..205 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:14 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
X 2043044..2043413 206..575 100 <- Minus
X 2043606..2043810 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:56 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1937077..1937446 206..575 100 <- Minus
arm_X 1937639..1937843 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:13 Download gff for FI16619.complete
Subject Subject Range Query Range Percent Splice Strand
X 2051142..2051511 206..575 100 <- Minus
X 2051704..2051908 1..205 100   Minus

FI16619.pep Sequence

Translation from 83 to 559

> FI16619.pep
MGRNNVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRS
QDAAYFQLYLDFEEFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSN
DNSSSDDYIGIMREYENLLYETGVYREEIEYLNQRIGALTVLNAELSKLH
ECSDSDVD*

FI16619.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21985-PA 174 GF21985-PA 1..174 1..156 404 51.1 Plus
Dana\GF12140-PA 263 GF12140-PA 29..87 6..62 148 45 Plus
Dana\GF12143-PA 424 GF12143-PA 3..62 5..62 140 38.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12658-PA 165 GG12658-PA 1..165 1..158 556 71.5 Plus
Dere\GG21853-PA 263 GG21853-PA 29..94 5..67 165 50 Plus
Dere\GG20622-PA 269 GG20622-PA 25..90 5..68 150 43.9 Plus
Dere\GG21854-PA 435 GG21854-PA 3..62 5..62 140 40 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24407-PA 147 GH24407-PA 19..131 5..141 263 43.1 Plus
Dgri\GH20284-PA 246 GH20284-PA 17..170 5..146 142 27.6 Plus
Dgri\GH22143-PA 433 GH22143-PA 3..49 5..51 142 48.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG4325-PB 158 CG4325-PB 1..158 1..158 856 100 Plus
CG4325-PA 158 CG4325-PA 1..158 1..158 856 100 Plus
CG10916-PB 263 CG10916-PB 29..94 5..67 168 50 Plus
CG10916-PA 263 CG10916-PA 29..94 5..67 168 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19373-PA 429 GI19373-PA 3..49 5..51 144 48.9 Plus
Dmoj\GI19455-PA 246 GI19455-PA 17..171 5..147 139 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15128-PA 141 GL15128-PA 1..141 1..156 439 58 Plus
Dper\GL17755-PA 432 GL17755-PA 3..49 5..51 141 46.8 Plus
Dper\GL17754-PA 253 GL17754-PA 15..77 5..64 139 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18110-PA 141 GA18110-PA 1..141 1..156 439 58 Plus
Dpse\GA18686-PA 431 GA18686-PA 3..49 5..51 141 46.8 Plus
Dpse\GA10640-PA 253 GA10640-PA 15..77 5..64 139 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18926-PA 151 GM18926-PA 1..151 1..158 655 89.9 Plus
Dsec\GM21853-PA 266 GM21853-PA 29..94 5..67 159 50 Plus
Dsec\GM21854-PA 432 GM21854-PA 3..62 5..62 143 40 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24619-PA 151 GD24619-PA 1..151 1..158 651 89.2 Plus
Dsim\GD11346-PA 263 GD11346-PA 29..94 5..67 162 50 Plus
Dsim\GD11347-PA 435 GD11347-PA 3..62 5..62 143 40 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16388-PA 146 GJ16388-PA 24..137 5..141 280 45.7 Plus
Dvir\GJ21206-PA 249 GJ21206-PA 18..174 3..147 139 25.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25745-PA 164 GK25745-PA 1..153 1..149 342 47.4 Plus
Dwil\GK22966-PA 266 GK22966-PA 33..94 5..64 146 43.5 Plus
Dwil\GK22967-PA 429 GK22967-PA 3..49 5..51 142 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16987-PA 168 GE16987-PA 1..168 1..158 570 72.6 Plus
Dyak\GE11932-PA 263 GE11932-PA 29..94 5..67 169 50 Plus
Dyak\GE11812-PA 269 GE11812-PA 25..87 5..64 159 49.2 Plus
Dyak\GE11933-PA 435 GE11933-PA 3..62 5..62 140 40 Plus

FI16619.hyp Sequence

Translation from 83 to 559

> FI16619.hyp
MGRNNVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRS
QDAAYFQLYLDFEEFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSN
DNSSSDDYIGIMREYENLLYETGVYREEIEYLNQRIGALTVLNAELSKLH
ECSDSDVD*

FI16619.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4325-PB 158 CG4325-PB 1..158 1..158 856 100 Plus
CG4325-PA 158 CG4325-PA 1..158 1..158 856 100 Plus
CG10916-PB 263 CG10916-PB 29..94 5..67 168 50 Plus
CG10916-PA 263 CG10916-PA 29..94 5..67 168 50 Plus