BDGP Sequence Production Resources |
Search the DGRC for FI16620
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 166 |
Well: | 20 |
Vector: | pOT2 |
Associated Gene/Transcript | Arpc3A-RC |
Protein status: | FI16620.pep: gold |
Sequenced Size: | 810 |
810 bp assembled on 2011-12-02
GenBank Submission: BT132882.1
> FI16620.complete TGGACGCCTATAATTAAAAACAATATTTAACATCGAAAAAATAACGTTTT CAACGTTAATTTAAATAATTAATTTAAAATACAATTCAACATGCCGGCCT ACCACTCGCAGATCAAGGAAGTGCGCCAGCAGGTGGGCAACATGGCCATC CTGCCGCTGAGGACGCAGGTGCGCGGGCCAGCGCCCAGTGCGAATATTGA GAGCGACATCATTGATGAGTCACTGTACTACTTCAAAGCCAATGTCTTCT TTCGCACGTACGAAATCAAGTCCGACGTGGATCGCGTGCTCATCTATGTG ACGCTCTACATAACAGAGTGCCTCAAGAAGCTCAATCGCTCCACGAGCAA GGCCCAGGGACAGCAGGACATGTACAGCCTGGCCATCTCCAAGTTCGACA TTCCCGGCGATGCTGGCTTCCCATTGAACGCCGTCTATGCCAAGCCGCAA ACGGCCCAGGATGCGGATCTGATGCGCCAGTACCTGCTGCAGCTGCGCCA CGAAACCGGCAACCGGGTACTGGAGAAGGTCTTCAACACCGAGGATGGCA AGCCCAATAAATGGTGGACCTGCTTCGCGAAGAAAAAGTTCATGGAGAAG AGTCTGGCTGGACCTGGACAATAAACAGCTATCCACAATATCTGGTATCT TGTTTTGCTTCTACGACGGGTAAAAATACCCTTCAATTAAGTTTTACTCG CAGCGTGGTCCTAATTTGCAGTATCACTGCCAACGTGTCACAATTAATTA AATTCATTAACCACTAAATAAATTATTTGAATTTGTAAAAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 11659804..11660321 | 269..786 | 2590 | 100 | Plus |
chr3R | 27901430 | chr3R | 11659521..11659695 | 96..270 | 875 | 100 | Plus |
chr3R | 27901430 | chr3R | 11659285..11659381 | 1..97 | 470 | 99 | Plus |
chrX | 22417052 | chrX | 16994178..16994338 | 618..458 | 325 | 80.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 15835195..15835714 | 269..788 | 2600 | 100 | Plus |
3R | 32079331 | 3R | 15834912..15835086 | 96..270 | 875 | 100 | Plus |
3R | 32079331 | 3R | 15834676..15834772 | 1..97 | 485 | 100 | Plus |
X | 23542271 | X | 17104648..17104808 | 618..458 | 310 | 79.5 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 15576026..15576545 | 269..788 | 2600 | 100 | Plus |
3R | 31820162 | 3R | 15575743..15575917 | 96..270 | 875 | 100 | Plus |
3R | 31820162 | 3R | 15575507..15575603 | 1..97 | 485 | 100 | Plus |
X | 23527363 | X | 17112746..17112906 | 618..458 | 310 | 79.5 | Minus |
X | 23527363 | X | 17113587..17113719 | 264..132 | 155 | 74.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11659522..11659695 | 97..270 | 100 | -> | Plus |
chr3R | 11659806..11660321 | 271..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc3A-RC | 1..534 | 91..624 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc3A-RC | 1..534 | 91..624 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc3A-RC | 1..534 | 91..624 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc3A-RC | 29..814 | 1..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc3A-RC | 29..814 | 1..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Arpc3A-RC | 29..814 | 1..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15834676..15834771 | 1..96 | 100 | -> | Plus |
3R | 15834913..15835086 | 97..270 | 100 | -> | Plus |
3R | 15835197..15835712 | 271..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15834676..15834771 | 1..96 | 100 | -> | Plus |
3R | 15834913..15835086 | 97..270 | 100 | -> | Plus |
3R | 15835197..15835712 | 271..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15834676..15834771 | 1..96 | 100 | -> | Plus |
3R | 15834913..15835086 | 97..270 | 100 | -> | Plus |
3R | 15835197..15835712 | 271..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11660635..11660808 | 97..270 | 100 | -> | Plus |
arm_3R | 11660398..11660493 | 1..96 | 100 | -> | Plus |
arm_3R | 11660919..11661434 | 271..786 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15576028..15576543 | 271..786 | 100 | Plus | |
3R | 15575507..15575602 | 1..96 | 100 | -> | Plus |
3R | 15575744..15575917 | 97..270 | 100 | -> | Plus |
Translation from 90 to 623
> FI16620.hyp MPAYHSQIKEVRQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKA NVFFRTYEIKSDVDRVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAIS KFDIPGDAGFPLNAVYAKPQTAQDADLMRQYLLQLRHETGNRVLEKVFNT EDGKPNKWWTCFAKKKFMEKSLAGPGQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Arpc3A-PE | 177 | CG4560-PE | 1..177 | 1..177 | 923 | 100 | Plus |
Arpc3A-PC | 177 | CG4560-PC | 1..177 | 1..177 | 923 | 100 | Plus |
Arpc3B-PA | 174 | CG8936-PA | 1..173 | 1..176 | 721 | 73.9 | Plus |
Arpc3B-PC | 157 | CG8936-PC | 1..156 | 18..176 | 666 | 76.1 | Plus |
Arpc3B-PB | 157 | CG8936-PB | 1..156 | 18..176 | 666 | 76.1 | Plus |
Translation from 90 to 623
> FI16620.pep MPAYHSQIKEVRQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKA NVFFRTYEIKSDVDRVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAIS KFDIPGDAGFPLNAVYAKPQTAQDADLMRQYLLQLRHETGNRVLEKVFNT EDGKPNKWWTCFAKKKFMEKSLAGPGQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18546-PA | 177 | GF18546-PA | 1..177 | 1..177 | 907 | 92.7 | Plus |
Dana\GF21827-PA | 157 | GF21827-PA | 1..156 | 18..176 | 699 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16957-PA | 177 | GG16957-PA | 1..177 | 1..177 | 953 | 99.4 | Plus |
Dere\GG18204-PA | 172 | GG18204-PA | 1..172 | 1..175 | 641 | 66.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19295-PA | 177 | GH19295-PA | 1..177 | 1..177 | 899 | 91 | Plus |
Dgri\GH24637-PA | 174 | GH24637-PA | 1..174 | 1..177 | 777 | 78.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Arpc3A-PE | 177 | CG4560-PE | 1..177 | 1..177 | 923 | 100 | Plus |
Arpc3A-PC | 177 | CG4560-PC | 1..177 | 1..177 | 923 | 100 | Plus |
Arpc3B-PA | 174 | CG8936-PA | 1..173 | 1..176 | 721 | 73.9 | Plus |
Arpc3B-PC | 157 | CG8936-PC | 1..156 | 18..176 | 666 | 76.1 | Plus |
Arpc3B-PB | 157 | CG8936-PB | 1..156 | 18..176 | 666 | 76.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23512-PA | 177 | GI23512-PA | 1..177 | 1..177 | 889 | 89.8 | Plus |
Dmoj\GI15826-PA | 173 | GI15826-PA | 1..173 | 1..176 | 741 | 76.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22074-PA | 177 | GL22074-PA | 1..177 | 1..177 | 903 | 92.7 | Plus |
Dper\GL18294-PA | 157 | GL18294-PA | 1..156 | 18..176 | 647 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27369-PA | 177 | GA27369-PA | 1..177 | 1..177 | 903 | 92.7 | Plus |
Dpse\GA27398-PA | 157 | GA27398-PA | 1..156 | 18..176 | 647 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24264-PA | 177 | GM24264-PA | 1..177 | 1..177 | 956 | 100 | Plus |
Dsec\GM13341-PA | 137 | GM13341-PA | 1..136 | 1..139 | 553 | 70.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19052-PA | 177 | GD19052-PA | 1..177 | 1..177 | 956 | 100 | Plus |
Dsim\GD15703-PA | 174 | GD15703-PA | 1..173 | 1..176 | 744 | 73.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10263-PA | 177 | GJ10263-PA | 1..177 | 1..177 | 900 | 91 | Plus |
Dvir\GJ18679-PA | 174 | GJ18679-PA | 1..174 | 1..177 | 775 | 78.5 | Plus |