Clone FI16620 Report

Search the DGRC for FI16620

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:20
Vector:pOT2
Associated Gene/TranscriptArpc3A-RC
Protein status:FI16620.pep: gold
Sequenced Size:810

Clone Sequence Records

FI16620.complete Sequence

810 bp assembled on 2011-12-02

GenBank Submission: BT132882.1

> FI16620.complete
TGGACGCCTATAATTAAAAACAATATTTAACATCGAAAAAATAACGTTTT
CAACGTTAATTTAAATAATTAATTTAAAATACAATTCAACATGCCGGCCT
ACCACTCGCAGATCAAGGAAGTGCGCCAGCAGGTGGGCAACATGGCCATC
CTGCCGCTGAGGACGCAGGTGCGCGGGCCAGCGCCCAGTGCGAATATTGA
GAGCGACATCATTGATGAGTCACTGTACTACTTCAAAGCCAATGTCTTCT
TTCGCACGTACGAAATCAAGTCCGACGTGGATCGCGTGCTCATCTATGTG
ACGCTCTACATAACAGAGTGCCTCAAGAAGCTCAATCGCTCCACGAGCAA
GGCCCAGGGACAGCAGGACATGTACAGCCTGGCCATCTCCAAGTTCGACA
TTCCCGGCGATGCTGGCTTCCCATTGAACGCCGTCTATGCCAAGCCGCAA
ACGGCCCAGGATGCGGATCTGATGCGCCAGTACCTGCTGCAGCTGCGCCA
CGAAACCGGCAACCGGGTACTGGAGAAGGTCTTCAACACCGAGGATGGCA
AGCCCAATAAATGGTGGACCTGCTTCGCGAAGAAAAAGTTCATGGAGAAG
AGTCTGGCTGGACCTGGACAATAAACAGCTATCCACAATATCTGGTATCT
TGTTTTGCTTCTACGACGGGTAAAAATACCCTTCAATTAAGTTTTACTCG
CAGCGTGGTCCTAATTTGCAGTATCACTGCCAACGTGTCACAATTAATTA
AATTCATTAACCACTAAATAAATTATTTGAATTTGTAAAAAAAAAAAAAA
AAAAAAAAAA

FI16620.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11659804..11660321 269..786 2590 100 Plus
chr3R 27901430 chr3R 11659521..11659695 96..270 875 100 Plus
chr3R 27901430 chr3R 11659285..11659381 1..97 470 99 Plus
chrX 22417052 chrX 16994178..16994338 618..458 325 80.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15835195..15835714 269..788 2600 100 Plus
3R 32079331 3R 15834912..15835086 96..270 875 100 Plus
3R 32079331 3R 15834676..15834772 1..97 485 100 Plus
X 23542271 X 17104648..17104808 618..458 310 79.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15576026..15576545 269..788 2600 100 Plus
3R 31820162 3R 15575743..15575917 96..270 875 100 Plus
3R 31820162 3R 15575507..15575603 1..97 485 100 Plus
X 23527363 X 17112746..17112906 618..458 310 79.5 Minus
X 23527363 X 17113587..17113719 264..132 155 74.4 Minus
Blast to na_te.dros performed 2019-03-15 11:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy12 10218 gypsy12 GYPSY12 10218bp 1836..1906 83..10 110 68.4 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9718..9788 83..10 110 68.4 Minus

FI16620.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:55:11 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11659522..11659695 97..270 100 -> Plus
chr3R 11659806..11660321 271..786 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 09:16:06 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 1..534 91..624 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:01 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 1..534 91..624 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:45:04 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 1..534 91..624 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 09:16:05 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 29..814 1..786 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:01 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 29..814 1..786 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:45:04 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 29..814 1..786 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:11 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834676..15834771 1..96 100 -> Plus
3R 15834913..15835086 97..270 100 -> Plus
3R 15835197..15835712 271..786 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:11 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834676..15834771 1..96 100 -> Plus
3R 15834913..15835086 97..270 100 -> Plus
3R 15835197..15835712 271..786 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:11 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834676..15834771 1..96 100 -> Plus
3R 15834913..15835086 97..270 100 -> Plus
3R 15835197..15835712 271..786 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:01 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11660635..11660808 97..270 100 -> Plus
arm_3R 11660398..11660493 1..96 100 -> Plus
arm_3R 11660919..11661434 271..786 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:43 Download gff for FI16620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15576028..15576543 271..786 100   Plus
3R 15575507..15575602 1..96 100 -> Plus
3R 15575744..15575917 97..270 100 -> Plus

FI16620.hyp Sequence

Translation from 90 to 623

> FI16620.hyp
MPAYHSQIKEVRQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKA
NVFFRTYEIKSDVDRVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAIS
KFDIPGDAGFPLNAVYAKPQTAQDADLMRQYLLQLRHETGNRVLEKVFNT
EDGKPNKWWTCFAKKKFMEKSLAGPGQ*

FI16620.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-PE 177 CG4560-PE 1..177 1..177 923 100 Plus
Arpc3A-PC 177 CG4560-PC 1..177 1..177 923 100 Plus
Arpc3B-PA 174 CG8936-PA 1..173 1..176 721 73.9 Plus
Arpc3B-PC 157 CG8936-PC 1..156 18..176 666 76.1 Plus
Arpc3B-PB 157 CG8936-PB 1..156 18..176 666 76.1 Plus

FI16620.pep Sequence

Translation from 90 to 623

> FI16620.pep
MPAYHSQIKEVRQQVGNMAILPLRTQVRGPAPSANIESDIIDESLYYFKA
NVFFRTYEIKSDVDRVLIYVTLYITECLKKLNRSTSKAQGQQDMYSLAIS
KFDIPGDAGFPLNAVYAKPQTAQDADLMRQYLLQLRHETGNRVLEKVFNT
EDGKPNKWWTCFAKKKFMEKSLAGPGQ*

FI16620.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18546-PA 177 GF18546-PA 1..177 1..177 907 92.7 Plus
Dana\GF21827-PA 157 GF21827-PA 1..156 18..176 699 76.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16957-PA 177 GG16957-PA 1..177 1..177 953 99.4 Plus
Dere\GG18204-PA 172 GG18204-PA 1..172 1..175 641 66.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19295-PA 177 GH19295-PA 1..177 1..177 899 91 Plus
Dgri\GH24637-PA 174 GH24637-PA 1..174 1..177 777 78.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-PE 177 CG4560-PE 1..177 1..177 923 100 Plus
Arpc3A-PC 177 CG4560-PC 1..177 1..177 923 100 Plus
Arpc3B-PA 174 CG8936-PA 1..173 1..176 721 73.9 Plus
Arpc3B-PC 157 CG8936-PC 1..156 18..176 666 76.1 Plus
Arpc3B-PB 157 CG8936-PB 1..156 18..176 666 76.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23512-PA 177 GI23512-PA 1..177 1..177 889 89.8 Plus
Dmoj\GI15826-PA 173 GI15826-PA 1..173 1..176 741 76.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22074-PA 177 GL22074-PA 1..177 1..177 903 92.7 Plus
Dper\GL18294-PA 157 GL18294-PA 1..156 18..176 647 73.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27369-PA 177 GA27369-PA 1..177 1..177 903 92.7 Plus
Dpse\GA27398-PA 157 GA27398-PA 1..156 18..176 647 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24264-PA 177 GM24264-PA 1..177 1..177 956 100 Plus
Dsec\GM13341-PA 137 GM13341-PA 1..136 1..139 553 70.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19052-PA 177 GD19052-PA 1..177 1..177 956 100 Plus
Dsim\GD15703-PA 174 GD15703-PA 1..173 1..176 744 73.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10263-PA 177 GJ10263-PA 1..177 1..177 900 91 Plus
Dvir\GJ18679-PA 174 GJ18679-PA 1..174 1..177 775 78.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12788-PA 178 GK12788-PA 1..178 1..177 879 91.6 Plus
Dwil\GK17662-PA 174 GK17662-PA 1..173 1..176 729 73.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24343-PA 177 GE24343-PA 1..177 1..177 953 99.4 Plus
Dyak\GE15621-PA 174 GE15621-PA 1..173 1..176 754 75 Plus