Clone FI16658 Report

Search the DGRC for FI16658

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:58
Vector:pOT2
Associated Gene/Transcriptix-RA
Protein status:FI16658.pep: gold
Sequenced Size:749

Clone Sequence Records

FI16658.complete Sequence

749 bp assembled on 2011-12-02

GenBank Submission: BT132874.1

> FI16658.complete
TTTTTCTTCACAAAAAGAAAACAATTCGCGGCTGTTCAATATTTTTCTCC
CCCAATATCCATCGATTTCGAGTGCCAAATGAATCCCAACATGAACATGA
TGCCCATGTCTGGGCCACAAATGATGCAGGTAATGCAATCCTCGCCATCG
GGACCCCCAGGACCAGTGCAGCATCAACAGCAGCAGCCTCCACAGCCACT
GCAGCAGCAGCAGCAGGCCGAAAAATTGGACAACATTTCCAGGGTGAAGA
GTTTGCTGGGACCACTGCGGGAGTCCATGTTCCTCACCATCCGGTCGAGC
GCCTTCGCGCTGCAGCAAAACAATCTCGCGGACAACTTAAAGAGGGACAC
GGGTGCCCACCATGTTCCGCGGTTCGACAAGCACTTGGAAGACTTTTACG
CCTGTTGCGACCAGATCGAGATCCACTTGAAGACGGCGATGCAGTGCCTC
CAGCAGCAGAACTCCTCCAATCACTATCTCCCCGGTCCGGTGACTCCCAT
GCGCATGGAGACCTTTATGCCGGACAACGCCGGCCCCATTTCGTATCCCA
CTTACTTGAACACGGTCCGCGTTCACATACAGTCCGCCAAGGATATACAC
GACACTCTGATTAGTGCCGCGCAGAACATTTCGCAGGCTGATTGATAGTT
GTAGTAGCATTAGGTTTTATTATTTCACACGCATGCACTTAAGTTAAGTA
AATAAATATTCTTAGATATAAGATAACAAAAAAAAAAAAAAAAAAAAAA

FI16658.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7246887..7247613 727..1 3635 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11359435..11360163 729..1 3645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11360634..11361362 729..1 3645 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:55:34 has no hits.

FI16658.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:56:42 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7246887..7247613 1..727 93   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 15:53:18 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
ix-RA 1..567 79..645 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:32 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
ix-RA 1..567 79..645 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:45:59 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
ix-RA 1..567 79..645 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 15:53:18 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
ix-RA 1..727 1..727 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:32 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
ix-RA 1..727 1..727 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:45:59 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
ix-RA 1..727 1..727 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:42 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11359437..11360163 1..727 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:42 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11359437..11360163 1..727 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:42 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11359437..11360163 1..727 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:32 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7246942..7247668 1..727 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:54 Download gff for FI16658.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11360636..11361362 1..727 100   Minus

FI16658.hyp Sequence

Translation from 0 to 644

> FI16658.hyp
FFFTKRKQFAAVQYFSPPISIDFECQMNPNMNMMPMSGPQMMQVMQSSPS
GPPGPVQHQQQQPPQPLQQQQQAEKLDNISRVKSLLGPLRESMFLTIRSS
AFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCL
QQQNSSNHYLPGPVTPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIH
DTLISAAQNISQAD*

FI16658.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
ix-PA 188 CG13201-PA 1..188 27..214 996 100 Plus

FI16658.pep Sequence

Translation from 0 to 644

> FI16658.pep
FFFTKRKQFAAVQYFSPPISIDFECQMNPNMNMMPMSGPQMMQVMQSSPS
GPPGPVQHQQQQPPQPLQQQQQAEKLDNISRVKSLLGPLRESMFLTIRSS
AFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCL
QQQNSSNHYLPGPVTPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIH
DTLISAAQNISQAD*

FI16658.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12399-PA 184 GF12399-PA 1..184 27..214 730 89.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22655-PA 189 GG22655-PA 1..189 27..214 962 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20513-PA 205 GH20513-PA 62..205 73..214 654 86.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
ix-PA 188 CG13201-PA 1..188 27..214 996 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21058-PA 210 GI21058-PA 67..210 73..214 661 87.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12116-PA 189 GA12116-PA 11..189 37..214 760 87.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20436-PA 184 GM20436-PA 1..184 31..214 964 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15252-PA 187 GD15252-PA 1..187 27..214 975 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21983-PA 205 GJ21983-PA 62..205 73..214 666 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24513-PA 191 GK24513-PA 17..191 43..214 689 79.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13530-PA 188 GE13530-PA 1..188 27..214 984 98.9 Plus