Clone Sequence Records
FI16659.complete Sequence
508 bp assembled on 2011-12-01
GenBank Submission: BT132868.1
> FI16659.complete
CCAAGCCTGCACTATGAATCCTACAATTTATTTGAGCTGCCTTATGGTCT
TCTCAGTGTTTCTGCTGGGAAAGGTAAATGCTGAGAACGAAGATGAGTTC
GTCACAGAAAAACAGCGCCTATTTAGTGTGTATGGTGATTCTTCGGTTGA
TGAGGCCACCAAATACCGGAACATCGACAGCCTGGTCACTTTCTACGATA
AGTACTTCACTCGACTTCAGTTGAAACCGGACTTGAACACACGCGCCCAT
GATCTCTTGAGGCGTTACAAGGAGGAAAATGCTCGTGTGGTCTTGGTGGA
CGGTACTCCCGCACAAGGCGGATTCTGGTTGCCACTGGTGAAGCTACTCA
TTGTCCAGCTGGGCGTCGAAATTGCCTCTGAGGGAGTCAAGCGTGCTATT
GAATCCTAATCCCTTCCATTAGGAATCAAATCAAATTGGATGTTTATTCA
ATATCATATGTAAAAATTTAAATAAATCTTTTTGAGCAAAGAAAAAAAAA
AAAAAAAA
FI16659.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:47:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 5329057..5329522 | 26..491 | 2300 | 99.6 | Plus |
chr2L | 23010047 | chr2L | 5328976..5329011 | 1..36 | 180 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5329958..5330426 | 26..494 | 2315 | 99.6 | Plus |
2L | 23513712 | 2L | 5329877..5329912 | 1..36 | 180 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5329958..5330426 | 26..494 | 2315 | 99.5 | Plus |
2L | 23513712 | 2L | 5329877..5329912 | 1..36 | 180 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 11:47:12 has no hits.
FI16659.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:48:04 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 5328976..5329011 | 1..36 | 100 | -> | Plus |
chr2L | 5329068..5329522 | 37..491 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 12:29:10 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotM-RA | 1..396 | 14..409 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:44 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotM-RA | 1..396 | 14..409 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:42:42 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotM-RA | 1..396 | 14..409 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 12:29:10 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotM-RA | 21..511 | 1..491 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:44 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotM-RA | 21..511 | 1..491 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:42:42 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotM-RA | 21..511 | 1..491 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:04 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5329877..5329912 | 1..36 | 100 | -> | Plus |
2L | 5329969..5330423 | 37..491 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:04 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5329877..5329912 | 1..36 | 100 | -> | Plus |
2L | 5329969..5330423 | 37..491 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:04 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5329877..5329912 | 1..36 | 100 | -> | Plus |
2L | 5329969..5330423 | 37..491 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:44 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5329877..5329912 | 1..36 | 100 | -> | Plus |
arm_2L | 5329969..5330423 | 37..491 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:05 Download gff for
FI16659.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5329969..5330423 | 37..491 | 100 | | Plus |
2L | 5329877..5329912 | 1..36 | 100 | -> | Plus |
FI16659.hyp Sequence
Translation from 0 to 408
> FI16659.hyp
QACTMNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVD
EATKYRNIDSLVTFYDKYFTRLQLKPDLNTRAHDLLRRYKEENARVVLVD
GTPAQGGFWLPLVKLLIVQLGVEIASEGVKRAIES*
FI16659.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotM-PB | 131 | CG14027-PB | 1..131 | 5..135 | 665 | 100 | Plus |
TotM-PA | 131 | CG14027-PA | 1..131 | 5..135 | 665 | 100 | Plus |
Victoria-PA | 134 | CG33117-PA | 16..126 | 5..117 | 204 | 38.1 | Plus |
TotF-PA | 125 | CG31691-PA | 6..123 | 14..133 | 190 | 39 | Plus |
FI16659.pep Sequence
Translation from 1 to 408
> FI16659.pep
QACTMNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVD
EATKYRNIDSLVTFYDKYFTRLQLKPDLNTRAHDLLRRYKEENARVVLVD
GTPAQGGFWLPLVKLLIVQLGVEIASEGVKRAIES*
FI16659.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:57:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25068-PA | 131 | GG25068-PA | 1..131 | 5..135 | 561 | 81.7 | Plus |
Dere\GG21584-PA | 130 | GG21584-PA | 1..111 | 5..117 | 146 | 32.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotM-PB | 131 | CG14027-PB | 1..131 | 5..135 | 665 | 100 | Plus |
TotM-PA | 131 | CG14027-PA | 1..131 | 5..135 | 665 | 100 | Plus |
Victoria-PA | 134 | CG33117-PA | 16..126 | 5..117 | 204 | 38.1 | Plus |
TotF-PA | 125 | CG31691-PA | 6..123 | 14..133 | 190 | 39 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24288-PA | 157 | GL24288-PA | 1..128 | 5..135 | 188 | 34.4 | Plus |
Dper\GL24287-PA | 230 | GL24287-PA | 115..196 | 25..108 | 183 | 45.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16081-PA | 137 | GA16081-PA | 4..103 | 7..108 | 215 | 45.6 | Plus |
Dpse\GA26557-PA | 157 | GA26557-PA | 1..128 | 5..135 | 188 | 34.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:57:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16981-PA | 117 | GM16981-PA | 1..109 | 5..116 | 190 | 38.4 | Plus |
Dsec\GM16980-PA | 134 | GM16980-PA | 16..126 | 5..117 | 172 | 37.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:57:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23335-PA | 131 | GD23335-PA | 1..131 | 5..135 | 603 | 87.8 | Plus |
Dsim\GD21729-PA | 125 | GD21729-PA | 6..123 | 14..133 | 197 | 37.4 | Plus |
Dsim\GD21728-PA | 119 | GD21728-PA | 1..111 | 5..117 | 174 | 37.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:57:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25388-PA | 131 | GE25388-PA | 1..131 | 5..135 | 569 | 81.7 | Plus |
Dyak\GE12622-PA | 128 | GE12622-PA | 1..119 | 5..121 | 149 | 35.2 | Plus |
Dyak\GE12623-PA | 134 | GE12623-PA | 16..116 | 5..107 | 139 | 35.6 | Plus |