Clone FI16659 Report

Search the DGRC for FI16659

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:59
Vector:pOT2
Associated Gene/TranscriptTotM-RA
Protein status:FI16659.pep: gold
Sequenced Size:508

Clone Sequence Records

FI16659.complete Sequence

508 bp assembled on 2011-12-01

GenBank Submission: BT132868.1

> FI16659.complete
CCAAGCCTGCACTATGAATCCTACAATTTATTTGAGCTGCCTTATGGTCT
TCTCAGTGTTTCTGCTGGGAAAGGTAAATGCTGAGAACGAAGATGAGTTC
GTCACAGAAAAACAGCGCCTATTTAGTGTGTATGGTGATTCTTCGGTTGA
TGAGGCCACCAAATACCGGAACATCGACAGCCTGGTCACTTTCTACGATA
AGTACTTCACTCGACTTCAGTTGAAACCGGACTTGAACACACGCGCCCAT
GATCTCTTGAGGCGTTACAAGGAGGAAAATGCTCGTGTGGTCTTGGTGGA
CGGTACTCCCGCACAAGGCGGATTCTGGTTGCCACTGGTGAAGCTACTCA
TTGTCCAGCTGGGCGTCGAAATTGCCTCTGAGGGAGTCAAGCGTGCTATT
GAATCCTAATCCCTTCCATTAGGAATCAAATCAAATTGGATGTTTATTCA
ATATCATATGTAAAAATTTAAATAAATCTTTTTGAGCAAAGAAAAAAAAA
AAAAAAAA

FI16659.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5329057..5329522 26..491 2300 99.6 Plus
chr2L 23010047 chr2L 5328976..5329011 1..36 180 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5329958..5330426 26..494 2315 99.6 Plus
2L 23513712 2L 5329877..5329912 1..36 180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5329958..5330426 26..494 2315 99.5 Plus
2L 23513712 2L 5329877..5329912 1..36 180 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:47:12 has no hits.

FI16659.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:48:04 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5328976..5329011 1..36 100 -> Plus
chr2L 5329068..5329522 37..491 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 12:29:10 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 1..396 14..409 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:44 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 1..396 14..409 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:42:42 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 1..396 14..409 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 12:29:10 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 21..511 1..491 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:44 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 21..511 1..491 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:42:42 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
TotM-RA 21..511 1..491 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:04 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5329877..5329912 1..36 100 -> Plus
2L 5329969..5330423 37..491 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:04 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5329877..5329912 1..36 100 -> Plus
2L 5329969..5330423 37..491 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:48:04 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5329877..5329912 1..36 100 -> Plus
2L 5329969..5330423 37..491 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:44 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5329877..5329912 1..36 100 -> Plus
arm_2L 5329969..5330423 37..491 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:05 Download gff for FI16659.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5329969..5330423 37..491 100   Plus
2L 5329877..5329912 1..36 100 -> Plus

FI16659.hyp Sequence

Translation from 0 to 408

> FI16659.hyp
QACTMNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVD
EATKYRNIDSLVTFYDKYFTRLQLKPDLNTRAHDLLRRYKEENARVVLVD
GTPAQGGFWLPLVKLLIVQLGVEIASEGVKRAIES*

FI16659.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
TotM-PB 131 CG14027-PB 1..131 5..135 665 100 Plus
TotM-PA 131 CG14027-PA 1..131 5..135 665 100 Plus
Victoria-PA 134 CG33117-PA 16..126 5..117 204 38.1 Plus
TotF-PA 125 CG31691-PA 6..123 14..133 190 39 Plus

FI16659.pep Sequence

Translation from 1 to 408

> FI16659.pep
QACTMNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVD
EATKYRNIDSLVTFYDKYFTRLQLKPDLNTRAHDLLRRYKEENARVVLVD
GTPAQGGFWLPLVKLLIVQLGVEIASEGVKRAIES*

FI16659.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25068-PA 131 GG25068-PA 1..131 5..135 561 81.7 Plus
Dere\GG21584-PA 130 GG21584-PA 1..111 5..117 146 32.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
TotM-PB 131 CG14027-PB 1..131 5..135 665 100 Plus
TotM-PA 131 CG14027-PA 1..131 5..135 665 100 Plus
Victoria-PA 134 CG33117-PA 16..126 5..117 204 38.1 Plus
TotF-PA 125 CG31691-PA 6..123 14..133 190 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24288-PA 157 GL24288-PA 1..128 5..135 188 34.4 Plus
Dper\GL24287-PA 230 GL24287-PA 115..196 25..108 183 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16081-PA 137 GA16081-PA 4..103 7..108 215 45.6 Plus
Dpse\GA26557-PA 157 GA26557-PA 1..128 5..135 188 34.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16981-PA 117 GM16981-PA 1..109 5..116 190 38.4 Plus
Dsec\GM16980-PA 134 GM16980-PA 16..126 5..117 172 37.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23335-PA 131 GD23335-PA 1..131 5..135 603 87.8 Plus
Dsim\GD21729-PA 125 GD21729-PA 6..123 14..133 197 37.4 Plus
Dsim\GD21728-PA 119 GD21728-PA 1..111 5..117 174 37.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25388-PA 131 GE25388-PA 1..131 5..135 569 81.7 Plus
Dyak\GE12622-PA 128 GE12622-PA 1..119 5..121 149 35.2 Plus
Dyak\GE12623-PA 134 GE12623-PA 16..116 5..107 139 35.6 Plus