Clone FI16672 Report

Search the DGRC for FI16672

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:166
Well:72
Vector:pOT2
Associated Gene/Transcriptd-cup-RA
Protein status:FI16672.pep: gold
Sequenced Size:1074

Clone Sequence Records

FI16672.complete Sequence

1074 bp assembled on 2011-12-02

GenBank Submission: BT132877.1

> FI16672.complete
TTACTTTATATTGAGTTCTTTGCGTTGCTTTCACATGTTCTTGTATCAAT
ACCAGCAAAGATGAAGTTGGACCTTACCATGAACGACCGTTTCAATCAGC
GGTTTCAGTCGGTTTATGGCGGACTTGTTCCCCAGATCGCCCGACTGGTG
CCCTTCAACGACTCTGAGGTGACCTGCATCCTGATGATCTACTACAAGTA
TAGTCTCCAGAATGGGCCCTCTGCTCGCCGAATAACATCCAGCCAGTTTG
TGAACATTGTGATCGGTTTCCAGCAGCTATATGACATGGACGTGGTGGAT
CGCATCGTAACCCTAATCGCAGGTGGCAGGAAACACGTGACGCCCATGGA
ATTTGTCAACTACATGACCATTCTAATGTCCCGCGACATGGAACGGAAAA
TGGAATTTGCATATATGGTTTACGACAAAAATGGCATGGGTATTAATAGA
GAGATCATTTCATCTTCGGTCGAGAGGTTTTTCGTCGGCGACGACGACGA
GGTACTCGAGATGCGACTGGACATGGTCGATTTTCTACTCCTCAAATTTG
ATGAAGACCAAGACGGCTACATCTCATTTGAGGAGTATAGATCGATCGTG
TTGCAGCAGCCGCGTCTGCTGGAGTTTCTGGGTCCCATCTTTCCCTCGGA
CGAGACGCGTCTGGTGGTGGCGTACTGCACTGCCATATACTCTCACATAC
CCGAAATGGGTACGTTGTAGGTATGATTGCAGAAGGGTATGTGGCATTTT
GCCAGAACTCCGCCAGTCACATAAATCTTTGAGGCACAAATAAATCGAAA
GCAATGCAAATCAGTGCGCCCCGCCACCGCGTTTTTCTCTGTTCAGCCAT
TGTAGCCACTCGAAAATGTCAATGACAATGATGATGAACTGCAGAATAGA
GCGCTGACAGCTGCAACGAGACGCTGGATAGATGGATAGATGGATGGAGC
ATATATAGGGGACACCAGCTGTCTCTCGACCACACGGGGAAAAATATTAA
AGATTACGATGGAATACTTAACATAAATATCAATAAAATAGAGTAACAAT
ACTTTCAAAAAAAAAAAAAAAAAA

FI16672.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8717951..8718488 519..1056 2690 100 Plus
chr3R 27901430 chr3R 8717325..8717743 1..419 2095 100 Plus
chr3R 27901430 chr3R 8717796..8717899 417..520 520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12892621..12893160 519..1058 2700 100 Plus
3R 32079331 3R 12891995..12892413 1..419 2095 100 Plus
3R 32079331 3R 12892466..12892569 417..520 520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12633452..12633991 519..1058 2700 100 Plus
3R 31820162 3R 12632826..12633244 1..419 2095 100 Plus
3R 31820162 3R 12633297..12633400 417..520 520 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:53:50 has no hits.

FI16672.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:54:59 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8717325..8717741 1..417 100 -> Plus
chr3R 8717797..8717898 418..519 100 -> Plus
chr3R 8717952..8718488 520..1056 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 08:39:30 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
d-cup-RA 1..660 61..720 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:52 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
d-cup-RA 1..660 61..720 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:44:42 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
d-cup-RA 1..660 61..720 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 08:39:29 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
d-cup-RA 1..1056 1..1056 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:52 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
d-cup-RA 40..1095 1..1056 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:44:42 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
d-cup-RA 40..1095 1..1056 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:59 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12891995..12892411 1..417 100 -> Plus
3R 12892467..12892568 418..519 100 -> Plus
3R 12892622..12893158 520..1056 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:59 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12891995..12892411 1..417 100 -> Plus
3R 12892467..12892568 418..519 100 -> Plus
3R 12892622..12893158 520..1056 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:59 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12891995..12892411 1..417 100 -> Plus
3R 12892467..12892568 418..519 100 -> Plus
3R 12892622..12893158 520..1056 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:52 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8717717..8718133 1..417 100 -> Plus
arm_3R 8718189..8718290 418..519 100 -> Plus
arm_3R 8718344..8718880 520..1056 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:39 Download gff for FI16672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12633298..12633399 418..519 100 -> Plus
3R 12632826..12633242 1..417 100 -> Plus
3R 12633453..12633989 520..1056 100   Plus

FI16672.hyp Sequence

Translation from 0 to 719

> FI16672.hyp
LLYIEFFALLSHVLVSIPAKMKLDLTMNDRFNQRFQSVYGGLVPQIARLV
PFNDSEVTCILMIYYKYSLQNGPSARRITSSQFVNIVIGFQQLYDMDVVD
RIVTLIAGGRKHVTPMEFVNYMTILMSRDMERKMEFAYMVYDKNGMGINR
EIISSSVERFFVGDDDEVLEMRLDMVDFLLLKFDEDQDGYISFEEYRSIV
LQQPRLLEFLGPIFPSDETRLVVAYCTAIYSHIPEMGTL*

FI16672.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
d-cup-PA 219 CG14387-PA 1..219 21..239 1124 100 Plus
sunz-PA 220 CG15179-PA 3..218 22..237 426 39.4 Plus
CG15177-PA 225 CG15177-PA 4..209 23..225 421 40.8 Plus
sowi-PA 217 CG15178-PA 4..209 23..226 420 37.9 Plus
CG15177-PB 217 CG15177-PB 4..201 23..225 381 39.3 Plus

FI16672.pep Sequence

Translation from 0 to 719

> FI16672.pep
LLYIEFFALLSHVLVSIPAKMKLDLTMNDRFNQRFQSVYGGLVPQIARLV
PFNDSEVTCILMIYYKYSLQNGPSARRITSSQFVNIVIGFQQLYDMDVVD
RIVTLIAGGRKHVTPMEFVNYMTILMSRDMERKMEFAYMVYDKNGMGINR
EIISSSVERFFVGDDDEVLEMRLDMVDFLLLKFDEDQDGYISFEEYRSIV
LQQPRLLEFLGPIFPSDETRLVVAYCTAIYSHIPEMGTL*

FI16672.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16917-PA 218 GF16917-PA 1..217 21..237 942 79.7 Plus
Dana\GF18370-PA 218 GF18370-PA 3..215 22..234 418 39.1 Plus
Dana\GF16646-PA 222 GF16646-PA 3..209 22..226 412 38.2 Plus
Dana\GF16647-PA 221 GF16647-PA 4..209 23..226 389 35 Plus
Dana\GF11793-PA 253 GF11793-PA 1..225 21..231 349 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19247-PA 219 GG19247-PA 1..219 21..239 1123 97.3 Plus
Dere\GG13568-PA 220 GG13568-PA 3..218 22..237 438 39.9 Plus
Dere\GG10380-PA 217 GG10380-PA 4..209 23..226 429 37.4 Plus
Dere\GG10369-PA 225 GG10369-PA 4..209 23..225 417 39.8 Plus
Dere\GG22989-PA 244 GG22989-PA 4..224 23..231 327 36.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15665-PA 218 GH15665-PA 3..215 22..234 460 40.2 Plus
Dgri\GH20009-PA 263 GH20009-PA 4..211 23..218 307 34.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
d-cup-PA 219 CG14387-PA 1..219 21..239 1124 100 Plus
sunz-PA 220 CG15179-PA 3..218 22..237 426 39.4 Plus
CG15177-PA 225 CG15177-PA 4..209 23..225 421 40.8 Plus
sowi-PA 217 CG15178-PA 4..209 23..226 420 37.9 Plus
CG15177-PB 217 CG15177-PB 4..201 23..225 381 39.3 Plus
CG3565-PA 244 CG3565-PA 4..224 23..231 323 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22488-PA 220 GI22488-PA 3..218 22..235 472 40.3 Plus
Dmoj\GI19190-PA 221 GI19190-PA 4..221 23..230 410 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21763-PA 220 GL21763-PA 3..218 22..235 468 40.7 Plus
Dper\GL22057-PA 224 GL22057-PA 4..209 23..226 444 39.3 Plus
Dper\GL10228-PA 234 GL10228-PA 3..228 22..235 378 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13552-PA 220 GA13552-PA 3..218 22..235 464 40.3 Plus
Dpse\GA13550-PA 224 GA13550-PA 4..209 23..226 444 39.3 Plus
Dpse\GA17523-PA 234 GA17523-PA 3..224 22..231 379 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24064-PA 219 GM24064-PA 1..219 21..239 1146 98.6 Plus
Dsec\GM10904-PA 220 GM10904-PA 3..215 22..234 430 40.5 Plus
Dsec\GM10540-PA 225 GM10540-PA 4..209 23..225 430 40.8 Plus
Dsec\GM10541-PA 217 GM10541-PA 4..209 23..226 429 37.9 Plus
Dsec\GM11883-PA 244 GM11883-PA 4..224 23..231 290 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18861-PA 219 GD18861-PA 1..219 21..239 1146 98.6 Plus
Dsim\GD19538-PA 225 GD19538-PA 4..209 23..225 430 40.8 Plus
Dsim\GD19539-PA 233 GD19539-PA 4..194 23..211 385 37.7 Plus
Dsim\GD19884-PA 197 GD19884-PA 3..197 22..216 373 38.6 Plus
Dsim\GD11881-PA 244 GD11881-PA 4..224 23..231 288 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20255-PA 224 GJ20255-PA 4..224 23..231 377 37.6 Plus
Dvir\GJ10087-PA 158 GJ10087-PA 3..157 22..174 288 34.2 Plus
Dvir\GJ23423-PA 63 GJ23423-PA 1..60 175..234 155 53.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11523-PA 219 GK11523-PA 4..209 23..226 434 39.3 Plus
Dwil\GK22790-PA 222 GK22790-PA 1..221 21..236 427 41.2 Plus
Dwil\GK11579-PA 214 GK11579-PA 3..200 22..217 410 39.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26222-PA 219 GE26222-PA 1..219 21..239 1135 97.7 Plus
Dyak\GE10232-PA 220 GE10232-PA 3..215 22..234 424 39.1 Plus
Dyak\GE24093-PA 225 GE24093-PA 4..209 23..225 423 40.3 Plus
Dyak\GE24094-PA 207 GE24094-PA 3..199 32..226 422 38.1 Plus
Dyak\GE14426-PA 244 GE14426-PA 4..224 23..231 295 36.2 Plus