Clone FI16804 Report

Search the DGRC for FI16804

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:4
Vector:pOT2
Associated Gene/TranscriptCG14397-RA
Protein status:FI16804.pep: gold
Sequenced Size:555

Clone Sequence Records

FI16804.complete Sequence

555 bp assembled on 2011-11-28

GenBank Submission: BT132837.1

> FI16804.complete
CCGCGTTCAAGTCAACAAGTGTCTTCGGCTCTTCGAATATCAAAACGGGC
TCTCGGTCCTTTGATTCAAAATCCAACCGAAGCTGCTTTTGCGAATATCT
TTATTGAATTTTAACAAGCTTACAAAATGTGCCTCCTGCCCGGTCGCTTC
TTCTGGTCAGCTTTCATTGTGACGATGGTGGGTCTATCCGCAACGATCGA
AGCTAGACCCCAGAGGAATCTGCAGCACATCGCCGTGGTGGAGAATGCCG
CCTGGGAAAAGACCCTTCCGCAGCAGTTCCAGAACCCCTTCTACAATACC
CCAAGGGTGAGAGATGCCCTGGCCAGATCCAGTTGGTTTGGACCCGGCGA
GGAGGTGGTTTATGACCGCCAGGCTGAAAAAATTCCTCGCATGGAAATCT
ACAATGTGTTGTCTCATGCTGGTTTGATACCACGCCGGCGTTTTCTTTAA
ATTATGAATATTTCAATACCGCATATCTGTTGTAAAATTATAAAAATAAA
AGTCAGTCATTAGTGTAGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

FI16804.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21092895..21093125 129..359 1155 100 Plus
chr2L 23010047 chr2L 21093188..21093350 357..519 815 100 Plus
chr2L 23010047 chr2L 21089727..21089857 1..131 655 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21094409..21094639 129..359 1155 100 Plus
2L 23513712 2L 21094702..21094869 357..524 840 100 Plus
2L 23513712 2L 21091241..21091371 1..131 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21094409..21094639 129..359 1155 100 Plus
2L 23513712 2L 21094702..21094869 357..524 840 100 Plus
2L 23513712 2L 21091241..21091371 1..131 655 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:43:23 has no hits.

FI16804.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:44:16 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21089727..21089854 1..128 100 -> Plus
chr2L 21092895..21093123 129..357 100 -> Plus
chr2L 21093189..21093350 358..519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-28 09:05:33 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 1..324 127..450 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:55 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 1..324 127..450 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:41:12 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 1..324 127..450 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-28 09:05:32 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 1..519 1..519 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:55 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 15..533 1..519 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:41:12 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 15..533 1..519 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:16 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21091241..21091368 1..128 100 -> Plus
2L 21094409..21094637 129..357 100 -> Plus
2L 21094703..21094864 358..519 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:16 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21091241..21091368 1..128 100 -> Plus
2L 21094409..21094637 129..357 100 -> Plus
2L 21094703..21094864 358..519 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:16 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21091241..21091368 1..128 100 -> Plus
2L 21094409..21094637 129..357 100 -> Plus
2L 21094703..21094864 358..519 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:55 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21091241..21091368 1..128 100 -> Plus
arm_2L 21094409..21094637 129..357 100 -> Plus
arm_2L 21094703..21094864 358..519 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:39 Download gff for FI16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21094703..21094864 358..519 100   Plus
2L 21094409..21094637 129..357 100 -> Plus
2L 21091241..21091368 1..128 100 -> Plus

FI16804.pep Sequence

Translation from 126 to 449

> FI16804.pep
MCLLPGRFFWSAFIVTMVGLSATIEARPQRNLQHIAVVENAAWEKTLPQQ
FQNPFYNTPRVRDALARSSWFGPGEEVVYDRQAEKIPRMEIYNVLSHAGL
IPRRRFL*

FI16804.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21063-PA 530 GF21063-PA 425..530 2..107 495 84.9 Plus
Dana\GF24370-PA 131 GF24370-PA 28..131 6..104 142 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21276-PA 123 GG21276-PA 18..123 2..107 542 95.3 Plus
Dere\GG14365-PA 126 GG14365-PA 54..126 34..104 137 41.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10407-PA 217 GH10407-PA 123..216 13..106 410 75.5 Plus
Dgri\GH16537-PA 126 GH16537-PA 54..126 34..104 144 41.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-PA 107 CG14397-PA 1..107 1..107 566 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23271-PA 107 GI23271-PA 13..105 13..105 394 79.6 Plus
Dmoj\GI13826-PA 141 GI13826-PA 64..141 22..104 139 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25885-PA 129 GL25885-PA 26..129 4..107 435 82.1 Plus
Dper\GL15072-PA 126 GL15072-PA 26..126 13..104 142 36.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25174-PA 154 GA25174-PA 51..154 4..107 442 83 Plus
Dpse\GA12195-PA 126 GA12195-PA 26..126 13..104 142 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23389-PA 91 GM23389-PA 1..91 17..107 473 98.9 Plus
Dsec\GM25109-PA 126 GM25109-PA 54..126 34..104 135 39.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24298-PA 117 GD24298-PA 11..117 1..107 565 99.1 Plus
Dsim\GD14145-PA 126 GD14145-PA 54..126 34..104 135 39.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23781-PA 131 GJ23781-PA 37..130 13..106 393 77.7 Plus
Dvir\GJ11692-PA 138 GJ11692-PA 66..138 34..104 136 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24315-PA 490 GK24315-PA 413..490 30..107 426 97.4 Plus
Dwil\GK12349-PA 132 GK12349-PA 60..132 34..104 147 42.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12892-PA 151 GE12892-PA 46..151 2..107 536 94.3 Plus
Dyak\GE20796-PA 126 GE20796-PA 54..126 34..104 136 39.7 Plus

FI16804.hyp Sequence

Translation from 126 to 449

> FI16804.hyp
MCLLPGRFFWSAFIVTMVGLSATIEARPQRNLQHIAVVENAAWEKTLPQQ
FQNPFYNTPRVRDALARSSWFGPGEEVVYDRQAEKIPRMEIYNVLSHAGL
IPRRRFL*

FI16804.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-PA 107 CG14397-PA 1..107 1..107 566 100 Plus