BDGP Sequence Production Resources |
Search the DGRC for FI16809
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 168 |
Well: | 9 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34180-RB |
Protein status: | FI16809.pep: gold |
Sequenced Size: | 389 |
389 bp assembled on 2011-11-23
GenBank Submission: BT132828.1
> FI16809.complete ATAAGCACAAAGTACAGGAATTCCTCGCAATGCTTTACAAATCTCTGCTG TTTTGCTTGGCGGCGGTTTTGTTCATTCCGGCGCATTCCGATGCCAAGGA ATATCAGTTCATCCCCGCTCGATGCGAGGAGCAGCCTGGAGTGGGTCAAC AGATTGGCGGTCCCTTAAGCATATGCAGCTTTCCACCAGACTATGCGAAA CCGGATTCAGAGGACATACAGGCCGTGATTAAACACATTAAGAGCTTGAA ATTGAATTGAGTCACACAAAAATTAGGCTTATTGAAACGTTTAGAGAACT ATACACTTTATAGGCATCAAGTCGCGCTCTGGTTAATGAAATCAATAAAA TTAGCTATAACTTTGTATCTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-B | 10654 | TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). | 10324..10364 | 74..34 | 115 | 75.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 6059566..6059665 | 1..100 | 100 | -> | Plus |
chr2L | 6059719..6059989 | 101..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34180-RB | 1..231 | 30..260 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34180-RB | 1..231 | 30..260 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34180-RB | 1..231 | 30..260 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34180-RB | 6..376 | 1..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34180-RB | 6..376 | 1..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34180-RB | 6..376 | 1..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6060515..6060614 | 1..100 | 100 | -> | Plus |
2L | 6060668..6060938 | 101..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6060515..6060614 | 1..100 | 100 | -> | Plus |
2L | 6060668..6060938 | 101..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6060515..6060614 | 1..100 | 100 | -> | Plus |
2L | 6060668..6060938 | 101..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 6060515..6060614 | 1..100 | 100 | -> | Plus |
arm_2L | 6060668..6060938 | 101..371 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6060668..6060938 | 101..371 | 100 | Plus | |
2L | 6060515..6060614 | 1..100 | 100 | -> | Plus |
Translation from 2 to 259
> FI16809.pep KHKVQEFLAMLYKSLLFCLAAVLFIPAHSDAKEYQFIPARCEEQPGVGQQ IGGPLSICSFPPDYAKPDSEDIQAVIKHIKSLKLN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10798-PA | 75 | GH10798-PA | 21..75 | 31..85 | 202 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34180-PB | 76 | CG34180-PB | 1..76 | 10..85 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19059-PA | 66 | GL19059-PA | 2..66 | 21..85 | 231 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25328-PA | 76 | GA25328-PA | 1..76 | 10..85 | 249 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18597-PA | 76 | GM18597-PA | 1..76 | 10..85 | 382 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15761-PA | 76 | GJ15761-PA | 1..76 | 10..85 | 241 | 59.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14721-PA | 76 | GK14721-PA | 1..76 | 10..85 | 259 | 65.8 | Plus |
Translation from 2 to 259
> FI16809.hyp KHKVQEFLAMLYKSLLFCLAAVLFIPAHSDAKEYQFIPARCEEQPGVGQQ IGGPLSICSFPPDYAKPDSEDIQAVIKHIKSLKLN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34180-PB | 76 | CG34180-PB | 1..76 | 10..85 | 400 | 100 | Plus |