Clone FI16809 Report

Search the DGRC for FI16809

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:9
Vector:pOT2
Associated Gene/TranscriptCG34180-RB
Protein status:FI16809.pep: gold
Sequenced Size:389

Clone Sequence Records

FI16809.complete Sequence

389 bp assembled on 2011-11-23

GenBank Submission: BT132828.1

> FI16809.complete
ATAAGCACAAAGTACAGGAATTCCTCGCAATGCTTTACAAATCTCTGCTG
TTTTGCTTGGCGGCGGTTTTGTTCATTCCGGCGCATTCCGATGCCAAGGA
ATATCAGTTCATCCCCGCTCGATGCGAGGAGCAGCCTGGAGTGGGTCAAC
AGATTGGCGGTCCCTTAAGCATATGCAGCTTTCCACCAGACTATGCGAAA
CCGGATTCAGAGGACATACAGGCCGTGATTAAACACATTAAGAGCTTGAA
ATTGAATTGAGTCACACAAAAATTAGGCTTATTGAAACGTTTAGAGAACT
ATACACTTTATAGGCATCAAGTCGCGCTCTGGTTAATGAAATCAATAAAA
TTAGCTATAACTTTGTATCTTAAAAAAAAAAAAAAAAAA

FI16809.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6059719..6059989 101..371 1355 100 Plus
chr2L 23010047 chr2L 6059566..6059669 1..104 505 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6060668..6060940 101..373 1365 100 Plus
2L 23513712 2L 6060515..6060618 1..104 505 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6060668..6060940 101..373 1365 100 Plus
2L 23513712 2L 6060515..6060618 1..104 505 99 Plus
Blast to na_te.dros performed 2019-03-15 11:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 10324..10364 74..34 115 75.6 Minus

FI16809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:30:06 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6059566..6059665 1..100 100 -> Plus
chr2L 6059719..6059989 101..371 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:27:49 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 1..231 30..260 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:10 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 1..231 30..260 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:02 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 1..231 30..260 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:27:48 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 6..376 1..371 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:10 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 6..376 1..371 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:02 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34180-RB 6..376 1..371 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:06 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6060515..6060614 1..100 100 -> Plus
2L 6060668..6060938 101..371 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:06 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6060515..6060614 1..100 100 -> Plus
2L 6060668..6060938 101..371 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:06 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6060515..6060614 1..100 100 -> Plus
2L 6060668..6060938 101..371 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:10 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6060515..6060614 1..100 100 -> Plus
arm_2L 6060668..6060938 101..371 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:27 Download gff for FI16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6060668..6060938 101..371 100   Plus
2L 6060515..6060614 1..100 100 -> Plus

FI16809.pep Sequence

Translation from 2 to 259

> FI16809.pep
KHKVQEFLAMLYKSLLFCLAAVLFIPAHSDAKEYQFIPARCEEQPGVGQQ
IGGPLSICSFPPDYAKPDSEDIQAVIKHIKSLKLN*

FI16809.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10798-PA 75 GH10798-PA 21..75 31..85 202 67.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34180-PB 76 CG34180-PB 1..76 10..85 400 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19059-PA 66 GL19059-PA 2..66 21..85 231 66.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25328-PA 76 GA25328-PA 1..76 10..85 249 61.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18597-PA 76 GM18597-PA 1..76 10..85 382 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15761-PA 76 GJ15761-PA 1..76 10..85 241 59.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14721-PA 76 GK14721-PA 1..76 10..85 259 65.8 Plus

FI16809.hyp Sequence

Translation from 2 to 259

> FI16809.hyp
KHKVQEFLAMLYKSLLFCLAAVLFIPAHSDAKEYQFIPARCEEQPGVGQQ
IGGPLSICSFPPDYAKPDSEDIQAVIKHIKSLKLN*

FI16809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34180-PB 76 CG34180-PB 1..76 10..85 400 100 Plus