Clone FI16811 Report

Search the DGRC for FI16811

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:11
Vector:pOT2
Associated Gene/TranscriptCG14563-RA
Protein status:FI16811.pep: gold
Sequenced Size:518

Clone Sequence Records

FI16811.complete Sequence

518 bp assembled on 2011-11-23

GenBank Submission: BT132799.1

> FI16811.complete
ATTACACACGATAAACATGGCCAGAAAAATCATGTCAGTGAAACAGTCGA
GCCGCTCTCCATGTTGTTGGTTCGGTTTGCTCCTGGTCGCCATTTTCCTG
CAGCCATCCGCGAGCCAATACTACGGTTATCCCTATTACGGCGGCGCTAA
TGCGGGAGCGGGATCGGGATACGGGAACATATACGGCAGCGGCATGTACG
GATACCCCTACAGCTACGGCGGATATCCGTACTACTCGTATCCCGGCTAC
AACCCGTACTCGATGTACGGTGGATACGGGCAGTACGGATACCCCTATGG
AGGATATCCCTACGGCGGCAATGGCATGAACGTGGCCTACGCCAGCAGCA
GTGGAGGATTCGCAACAGCCAGTGCGGGTGGAAGCGGATACTACGGCTAG
GAAGCGCGAAACCTGATATAGTTTAGTGATAGGTATACGGTTAAGTCATC
CTACCCCATAAGTGTGTTAGTGCTAATAAATATGATATTTATGTTCTATA
AAAAAAAAAAAAAAAAAA

FI16811.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21830993..21831321 329..1 1645 100 Minus
chr3L 24539361 chr3L 21830743..21830912 499..330 850 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21842058..21842386 329..1 1645 100 Minus
3L 28110227 3L 21841806..21841977 501..330 860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21835158..21835486 329..1 1645 100 Minus
3L 28103327 3L 21834906..21835077 501..330 860 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:25:33 has no hits.

FI16811.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:19 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21830743..21830912 330..499 100 <- Minus
chr3L 21830993..21831321 1..329 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:32 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 1..369 32..400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:43 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 1..369 32..400 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:42 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 1..369 32..400 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:31 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 1..499 1..499 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:43 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 1..499 1..499 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:42 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 1..499 1..499 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:19 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21841808..21841977 330..499 100 <- Minus
3L 21842058..21842386 1..329 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:19 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21841808..21841977 330..499 100 <- Minus
3L 21842058..21842386 1..329 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:19 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21841808..21841977 330..499 100 <- Minus
3L 21842058..21842386 1..329 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:43 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21834908..21835077 330..499 100 <- Minus
arm_3L 21835158..21835486 1..329 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:38:59 Download gff for FI16811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21835158..21835486 1..329 100   Minus
3L 21834908..21835077 330..499 100 <- Minus

FI16811.hyp Sequence

Translation from 0 to 399

> FI16811.hyp
LHTINMARKIMSVKQSSRSPCCWFGLLLVAIFLQPSASQYYGYPYYGGAN
AGAGSGYGNIYGSGMYGYPYSYGGYPYYSYPGYNPYSMYGGYGQYGYPYG
GYPYGGNGMNVAYASSSGGFATASAGGSGYYG*

FI16811.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-PA 122 CG14563-PA 1..122 11..132 698 100 Plus
CG9269-PA 146 CG9269-PA 48..142 42..132 138 43.7 Plus

FI16811.pep Sequence

Translation from 16 to 399

> FI16811.pep
MARKIMSVKQSSRSPCCWFGLLLVAIFLQPSASQYYGYPYYGGANAGAGS
GYGNIYGSGMYGYPYSYGGYPYYSYPGYNPYSMYGGYGQYGYPYGGYPYG
GNGMNVAYASSSGGFATASAGGSGYYG*

FI16811.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23501-PA 125 GF23501-PA 91..125 93..127 136 85.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13194-PA 123 GG13194-PA 1..123 6..127 153 90.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-PA 122 CG14563-PA 1..122 6..127 698 100 Plus
CG9269-PA 146 CG9269-PA 48..142 37..127 138 43.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12082-PA 126 GD12082-PA 1..126 6..127 531 95.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22706-PA 124 GE22706-PA 1..124 6..127 185 88.7 Plus