Clone Sequence Records
FI16811.complete Sequence
518 bp assembled on 2011-11-23
GenBank Submission: BT132799.1
> FI16811.complete
ATTACACACGATAAACATGGCCAGAAAAATCATGTCAGTGAAACAGTCGA
GCCGCTCTCCATGTTGTTGGTTCGGTTTGCTCCTGGTCGCCATTTTCCTG
CAGCCATCCGCGAGCCAATACTACGGTTATCCCTATTACGGCGGCGCTAA
TGCGGGAGCGGGATCGGGATACGGGAACATATACGGCAGCGGCATGTACG
GATACCCCTACAGCTACGGCGGATATCCGTACTACTCGTATCCCGGCTAC
AACCCGTACTCGATGTACGGTGGATACGGGCAGTACGGATACCCCTATGG
AGGATATCCCTACGGCGGCAATGGCATGAACGTGGCCTACGCCAGCAGCA
GTGGAGGATTCGCAACAGCCAGTGCGGGTGGAAGCGGATACTACGGCTAG
GAAGCGCGAAACCTGATATAGTTTAGTGATAGGTATACGGTTAAGTCATC
CTACCCCATAAGTGTGTTAGTGCTAATAAATATGATATTTATGTTCTATA
AAAAAAAAAAAAAAAAAA
FI16811.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 21830993..21831321 | 329..1 | 1645 | 100 | Minus |
chr3L | 24539361 | chr3L | 21830743..21830912 | 499..330 | 850 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 21842058..21842386 | 329..1 | 1645 | 100 | Minus |
3L | 28110227 | 3L | 21841806..21841977 | 501..330 | 860 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:17:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 21835158..21835486 | 329..1 | 1645 | 100 | Minus |
3L | 28103327 | 3L | 21834906..21835077 | 501..330 | 860 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 11:25:33 has no hits.
FI16811.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:19 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 21830743..21830912 | 330..499 | 100 | <- | Minus |
chr3L | 21830993..21831321 | 1..329 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:32 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14563-RA | 1..369 | 32..400 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:43 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14563-RA | 1..369 | 32..400 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:42 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14563-RA | 1..369 | 32..400 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:31 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14563-RA | 1..499 | 1..499 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:43 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14563-RA | 1..499 | 1..499 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:42 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14563-RA | 1..499 | 1..499 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:19 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 21841808..21841977 | 330..499 | 100 | <- | Minus |
3L | 21842058..21842386 | 1..329 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:19 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 21841808..21841977 | 330..499 | 100 | <- | Minus |
3L | 21842058..21842386 | 1..329 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:19 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 21841808..21841977 | 330..499 | 100 | <- | Minus |
3L | 21842058..21842386 | 1..329 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:43 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 21834908..21835077 | 330..499 | 100 | <- | Minus |
arm_3L | 21835158..21835486 | 1..329 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:38:59 Download gff for
FI16811.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 21835158..21835486 | 1..329 | 100 | | Minus |
3L | 21834908..21835077 | 330..499 | 100 | <- | Minus |
FI16811.hyp Sequence
Translation from 0 to 399
> FI16811.hyp
LHTINMARKIMSVKQSSRSPCCWFGLLLVAIFLQPSASQYYGYPYYGGAN
AGAGSGYGNIYGSGMYGYPYSYGGYPYYSYPGYNPYSMYGGYGQYGYPYG
GYPYGGNGMNVAYASSSGGFATASAGGSGYYG*
FI16811.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14563-PA | 122 | CG14563-PA | 1..122 | 11..132 | 698 | 100 | Plus |
CG9269-PA | 146 | CG9269-PA | 48..142 | 42..132 | 138 | 43.7 | Plus |
FI16811.pep Sequence
Translation from 16 to 399
> FI16811.pep
MARKIMSVKQSSRSPCCWFGLLLVAIFLQPSASQYYGYPYYGGANAGAGS
GYGNIYGSGMYGYPYSYGGYPYYSYPGYNPYSMYGGYGQYGYPYGGYPYG
GNGMNVAYASSSGGFATASAGGSGYYG*
FI16811.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:02:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF23501-PA | 125 | GF23501-PA | 91..125 | 93..127 | 136 | 85.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:02:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13194-PA | 123 | GG13194-PA | 1..123 | 6..127 | 153 | 90.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14563-PA | 122 | CG14563-PA | 1..122 | 6..127 | 698 | 100 | Plus |
CG9269-PA | 146 | CG9269-PA | 48..142 | 37..127 | 138 | 43.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:02:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12082-PA | 126 | GD12082-PA | 1..126 | 6..127 | 531 | 95.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:02:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22706-PA | 124 | GE22706-PA | 1..124 | 6..127 | 185 | 88.7 | Plus |