Clone FI16812 Report

Search the DGRC for FI16812

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:12
Vector:pOT2
Associated Gene/TranscriptGstD2-RA
Protein status:FI16812.pep: gold
Sequenced Size:755

Clone Sequence Records

FI16812.complete Sequence

755 bp assembled on 2011-11-23

GenBank Submission: BT132814.1

> FI16812.complete
GTTAACAACCAGTTGCAATATCCCCAACATGGACTTTTACTACATGCCAG
GTGGTGGAGGATGCCGCACGGTCATCATGGTGGCCAAGGCTCTCGGCCTG
GAGCTGAACAAGAAGCTACTGAACACCATGGAGGGTGAACAATTGAAGCC
GGAGTTTGTTAAGCTCAATCCACAGCACACCATTCCCACGCTGGTGGACA
ACGGATTCTCCATCTGGGAGTCCCGGGCCATCGCCGTCTATCTGGTGGAG
AAGTACGGCAAGGATGACTATCTGTTGCCCAACGATCCCAAGAAGCGTGC
CGTGATCAACCAGCGTCTGTACTTCGACATGGGAACTCTGTACGAAAGCT
TTGCCAAATACTACTATCCCCTTTTCCGCACTGGAAAGCCCGGATCGGAT
GAGGACTTGAAGAGAATCGAAACCGCGTTTGGATTTCTCGACACCTTCCT
GGAGGGCCAGGAGTATGTGGCTGGCGACCAGCTCACCGTGGCGGACATTG
CCATCCTGTCCACTGTCTCCACGTTCGAAGTTAGTGAGTTCGACTTCAGC
AAGTACTCCAATGTCTCCAGGTGGTACGACAATGCCAAGAAGGTGACTCC
AGGATGGGATGAGAACTGGGAGGGCCTCATGGCGATGAAGGCGTTGTTCG
ATGCCCGTAAATTGGCGGCTAAGTGATCGGTATCACAACTATTTATTGTT
TATTTATGAAACTGTTGAATTAAACGAAATAAATTAAAAAAAAAAAAAAA
AAAAA

FI16812.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8197347..8198081 1..735 3675 100 Plus
chr3R 27901430 chr3R 8201182..8201735 59..619 1450 84.3 Plus
chr3R 27901430 chr3R 8199569..8200134 59..624 940 77.7 Plus
chr3R 27901430 chr3R 8193354..8193912 620..62 815 76.4 Minus
chr3R 27901430 chr3R 8203985..8204433 77..522 665 77.1 Plus
chr3R 27901430 chr3R 8205472..8206010 83..621 595 74 Plus
chr3R 27901430 chr3R 8202657..8202886 133..362 415 78.7 Plus
chr3R 27901430 chr3R 8191929..8192154 371..146 350 77 Minus
chr3R 27901430 chr3R 8198517..8198772 77..332 350 75.8 Plus
chr3R 27901430 chr3R 8190579..8190783 369..165 320 77.1 Minus
chr3R 27901430 chr3R 8198881..8199060 441..620 300 77.8 Plus
chr3R 27901430 chr3R 8191669..8191725 625..569 195 89.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12371970..12372705 1..736 3680 100 Plus
3R 32079331 3R 12375794..12376354 59..619 1590 85.6 Plus
3R 32079331 3R 12374183..12374748 59..624 940 77.7 Plus
3R 32079331 3R 12367977..12368535 620..62 815 76.4 Minus
3R 32079331 3R 12378603..12379051 77..522 665 77.1 Plus
3R 32079331 3R 12380090..12380628 83..621 595 74 Plus
3R 32079331 3R 12377276..12377505 133..362 415 78.7 Plus
3R 32079331 3R 12366552..12366777 371..146 350 77 Minus
3R 32079331 3R 12373130..12373385 77..332 350 75.8 Plus
3R 32079331 3R 12365202..12365406 369..165 320 77.1 Minus
3R 32079331 3R 12373494..12373673 441..620 300 77.8 Plus
3R 32079331 3R 12366292..12366348 625..569 195 89.5 Minus
3R 32079331 3R 12364951..12365082 620..489 180 75.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12112801..12113536 1..736 3680 100 Plus
3R 31820162 3R 12116625..12116986 59..420 1210 88.9 Plus
3R 31820162 3R 12115014..12115295 59..340 675 82.6 Plus
3R 31820162 3R 12119434..12119618 77..261 535 85.9 Plus
3R 31820162 3R 12117011..12117185 445..619 440 83.4 Plus
3R 31820162 3R 12118107..12118336 133..362 415 78.6 Plus
3R 31820162 3R 12115372..12115579 417..624 380 78.8 Plus
3R 31820162 3R 12109166..12109294 262..134 375 86 Minus
3R 31820162 3R 12120921..12121069 83..231 370 83.2 Plus
3R 31820162 3R 12113961..12114216 77..332 350 75.7 Plus
3R 31820162 3R 12114325..12114504 441..620 300 77.7 Plus
3R 31820162 3R 12109062..12109141 366..287 280 90 Minus
3R 31820162 3R 12108808..12108889 620..539 260 87.8 Minus
3R 31820162 3R 12107532..12107608 222..146 220 85.7 Minus
3R 31820162 3R 12106116..12106237 286..165 220 78.6 Minus
3R 31820162 3R 12121278..12121340 440..502 210 88.8 Plus
3R 31820162 3R 12119783..12119882 423..522 200 80 Plus
3R 31820162 3R 12121081..12121179 243..341 195 79.7 Plus
3R 31820162 3R 12107123..12107179 625..569 195 89.4 Minus
3R 31820162 3R 12121398..12121459 560..621 190 87 Plus
3R 31820162 3R 12119638..12119705 278..345 190 85.2 Plus
3R 31820162 3R 12107383..12107515 371..239 185 75.9 Minus
3R 31820162 3R 12106033..12106099 369..303 155 82 Minus
3R 31820162 3R 12105782..12105830 620..572 140 85.7 Minus
Blast to na_te.dros performed on 2019-03-15 11:38:17 has no hits.

FI16812.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:38:59 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8197347..8198081 1..735 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 14:11:40 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
GstD2-RA 1..648 29..676 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:30 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
GstD2-RA 1..648 29..676 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:40:15 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
GstD2-RA 1..648 29..676 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 14:11:40 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
GstD2-RA 1..734 2..735 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:30 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
GstD2-RA 1..734 2..735 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:40:15 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
GstD2-RA 1..734 2..735 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:59 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12371970..12372704 1..735 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:59 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12371970..12372704 1..735 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:38:59 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12371970..12372704 1..735 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:30 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8197692..8198426 1..735 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:38:48 Download gff for FI16812.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12112801..12113535 1..735 100   Plus

FI16812.hyp Sequence

Translation from 0 to 675

> FI16812.hyp
LTTSCNIPNMDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKP
EFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRA
VINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFL
EGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTP
GWDENWEGLMAMKALFDARKLAAK*

FI16812.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
GstD2-PA 215 CG4181-PA 1..215 10..224 1134 100 Plus
GstD5-PA 216 CG12242-PA 1..215 10..224 930 79.1 Plus
GstD4-PA 215 CG11512-PA 1..215 10..224 877 75.3 Plus
GstD1-PB 209 CG10045-PB 2..209 10..217 802 70.2 Plus
GstD1-PA 209 CG10045-PA 2..209 10..217 802 70.2 Plus

FI16812.pep Sequence

Translation from 1 to 675

> FI16812.pep
LTTSCNIPNMDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKP
EFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRA
VINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFL
EGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTP
GWDENWEGLMAMKALFDARKLAAK*

FI16812.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17943-PA 218 GF17943-PA 1..205 10..213 875 78 Plus
Dana\GF17052-PA 209 GF17052-PA 2..209 10..217 805 69.7 Plus
Dana\GF17947-PA 214 GF17947-PA 1..211 10..220 775 63.5 Plus
Dana\GF17942-PA 398 GF17942-PA 185..384 16..215 771 68 Plus
Dana\GF17944-PA 219 GF17944-PA 1..214 10..221 759 66.4 Plus
Dana\GF17942-PA 398 GF17942-PA 1..198 26..224 654 59.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18761-PA 215 GG18761-PA 1..215 10..224 1096 94.9 Plus
Dere\GG18783-PA 216 GG18783-PA 1..215 10..224 949 79.5 Plus
Dere\GstD1-PA 209 GG17135-PA 3..209 11..217 811 70.5 Plus
Dere\GG18806-PA 212 GG18806-PA 1..204 10..213 776 66.7 Plus
Dere\GG18772-PA 215 GG18772-PA 1..215 10..224 771 63.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20186-PA 209 GH20186-PA 3..209 11..217 807 71 Plus
Dgri\GH13103-PA 209 GH13103-PA 3..209 11..217 804 70.5 Plus
Dgri\GH17521-PA 216 GH17521-PA 1..210 10..219 802 68.1 Plus
Dgri\GH20559-PA 216 GH20559-PA 1..210 10..219 801 68.1 Plus
Dgri\GH20548-PA 213 GH20548-PA 1..204 10..213 733 63.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
GstD2-PA 215 CG4181-PA 1..215 10..224 1134 100 Plus
GstD5-PA 216 CG12242-PA 1..215 10..224 930 79.1 Plus
GstD4-PA 215 CG11512-PA 1..215 10..224 877 75.3 Plus
GstD1-PB 209 CG10045-PB 2..209 10..217 802 70.2 Plus
GstD1-PA 209 CG10045-PA 2..209 10..217 802 70.2 Plus
GstD8-PA 212 CG4421-PA 1..210 10..219 772 66.2 Plus
GstD7-PA 224 CG4371-PA 1..208 7..213 743 68.3 Plus
GstD10-PB 210 CG18548-PB 1..209 10..217 726 62.7 Plus
GstD10-PA 210 CG18548-PA 1..209 10..217 726 62.7 Plus
GstD3-PA 199 CG4381-PA 1..199 26..224 723 65.3 Plus
GstD6-PA 215 CG4423-PA 1..204 10..213 700 63.2 Plus
GstD9-PB 218 CG10091-PB 2..210 10..216 695 61.7 Plus
GstD9-PA 218 CG10091-PA 2..210 10..216 695 61.7 Plus
GstD11-PA 222 CG17639-PA 7..216 13..224 469 42.9 Plus
GstD11-PB 243 CG17639-PB 28..237 13..224 469 42.9 Plus
GstE1-PA 224 CG5164-PA 18..196 22..198 356 43 Plus
GstE3-PA 220 CG17524-PA 4..199 10..204 352 38.1 Plus
GstE7-PA 223 CG17531-PA 1..200 7..204 346 40.1 Plus
GstE8-PB 222 CG17533-PB 16..200 22..204 342 38.2 Plus
GstE8-PA 222 CG17533-PA 16..200 22..204 342 38.2 Plus
GstE6-PA 222 CG17530-PA 16..213 22..216 336 37 Plus
GstE12-PC 223 CG16936-PC 7..216 13..219 334 36.2 Plus
GstE12-PB 223 CG16936-PB 7..216 13..219 334 36.2 Plus
GstE12-PD 223 CG16936-PD 7..216 13..219 334 36.2 Plus
GstE12-PA 223 CG16936-PA 7..216 13..219 334 36.2 Plus
GstE10-PB 240 CG17522-PB 3..189 9..191 333 39.6 Plus
GstE10-PA 240 CG17522-PA 3..189 9..191 333 39.6 Plus
GstE11-PB 225 CG5224-PB 8..208 13..209 323 37.1 Plus
GstE11-PA 225 CG5224-PA 8..208 13..209 323 37.1 Plus
GstE2-PA 221 CG17523-PA 17..206 22..209 320 37.4 Plus
GstE4-PA 222 CG17525-PA 4..205 10..208 319 34.7 Plus
GstE5-PA 222 CG17527-PA 16..212 22..215 309 37.1 Plus
GstE9-PA 221 CG17534-PA 16..190 22..193 301 39 Plus
gfzf-PE 1045 CG33546-PE 809..1019 7..214 287 34.4 Plus
gfzf-PB 1045 CG33546-PB 809..1019 7..214 287 34.4 Plus
gfzf-PD 234 CG33546-PD 1..208 10..214 286 34.4 Plus
GstE13-PB 226 CG11784-PB 7..211 13..213 271 33.2 Plus
GstE13-PA 226 CG11784-PA 7..211 13..213 271 33.2 Plus
GstE14-PA 232 CG4688-PA 4..214 8..218 262 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22354-PA 208 GI22354-PA 1..208 10..217 848 75 Plus
Dmoj\GI24379-PA 209 GI24379-PA 2..209 10..217 819 71.6 Plus
Dmoj\GI23195-PA 216 GI23195-PA 1..210 10..219 788 65.2 Plus
Dmoj\GI23193-PA 214 GI23193-PA 1..201 10..213 766 68.6 Plus
Dmoj\GI23194-PA 213 GI23194-PA 1..204 10..213 750 65.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27300-PA 217 GL27300-PA 1..215 10..224 903 74.4 Plus
Dper\GL27184-PA 209 GL27184-PA 3..209 11..217 823 72 Plus
Dper\GL27302-PA 215 GL27302-PA 1..211 10..220 764 64.9 Plus
Dper\GL27303-PA 213 GL27303-PA 1..212 10..220 755 63.2 Plus
Dper\GL27301-PA 213 GL27301-PA 1..212 10..220 749 64.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18009-PA 219 GA18009-PA 1..215 10..224 894 73.5 Plus
Dpse\GA10031-PA 209 GA10031-PA 3..209 11..217 823 72 Plus
Dpse\GA27028-PA 215 GA27028-PA 1..211 10..220 761 64.9 Plus
Dpse\GA18171-PA 213 GA18171-PA 1..212 10..220 748 63.2 Plus
Dpse\GA27027-PA 213 GA27027-PA 1..212 10..220 741 63.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24018-PA 215 GM24018-PA 1..215 10..224 876 74 Plus
Dsec\GstD1-PA 209 GM26019-PA 3..209 11..217 807 70 Plus
Dsec\GM24021-PA 212 GM24021-PA 1..210 10..219 793 66.7 Plus
Dsec\GM24017-PA 215 GM24017-PA 1..215 10..224 782 64.7 Plus
Dsec\GM24020-PA 218 GM24020-PA 1..213 7..218 742 64.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18815-PA 215 GD18815-PA 1..215 10..224 1114 96.7 Plus
Dsim\GD18818-PA 216 GD18818-PA 1..215 10..224 925 78.1 Plus
Dsim\GD18817-PA 215 GD18817-PA 1..215 10..224 892 75.8 Plus
Dsim\GstD1-PA 209 GD20577-PA 3..209 11..217 807 70 Plus
Dsim\GD18821-PA 212 GD18821-PA 1..210 10..219 790 66.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24385-PA 209 GJ24385-PA 3..209 11..217 798 70 Plus
Dvir\GJ22852-PA 214 GJ22852-PA 1..208 10..220 757 64 Plus
Dvir\GJ22855-PA 200 GJ22855-PA 1..194 26..219 756 68.6 Plus
Dvir\GJ22854-PA 213 GJ22854-PA 1..204 10..213 756 66.2 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 1..213 10..224 754 62.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11874-PA 219 GK11874-PA 1..215 10..224 878 72.6 Plus
Dwil\GK11202-PA 218 GK11202-PA 4..218 10..224 869 73.5 Plus
Dwil\GK11875-PA 214 GK11875-PA 1..213 10..222 808 67.6 Plus
Dwil\GK11204-PA 209 GK11204-PA 3..209 11..217 807 70.5 Plus
Dwil\GK11878-PA 212 GK11878-PA 1..210 10..220 753 63 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26175-PA 215 GE26175-PA 1..215 10..224 1083 93.5 Plus
Dyak\GE26178-PA 216 GE26178-PA 1..215 10..224 962 80.5 Plus
Dyak\GE26173-PA 215 GE26173-PA 1..215 10..224 961 82.3 Plus
Dyak\GE26177-PA 215 GE26177-PA 1..215 10..224 905 76.7 Plus
Dyak\GstD1-PA 209 GE24527-PA 3..209 11..217 801 69.6 Plus