Clone FI16813 Report

Search the DGRC for FI16813

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:13
Vector:pOT2
Associated Gene/TranscriptCG34005-RB
Protein status:FI16813.pep: gold
Sequenced Size:633

Clone Sequence Records

FI16813.complete Sequence

633 bp assembled on 2011-11-23

GenBank Submission: BT132794.1

> FI16813.complete
ATCAGTGCCATGAAAACAGCTATCATTCTGCTTATAGCCCTTGGGGCATG
TGCTGCTGAGCCTTCTCCCCGAACTCTAAACTCATTTTGCTCTTACTTAG
ACGATGGAAAGGAAACTGTTTCGAGTCTGGGCAACACCAAGAAGTGTTTT
GCTCGTTACCTACCGGAACTGGAAAGTGAAGGGGCTACCTGGTCGCAAGG
ATATAATGCCTGTCAGAAGATTACCATTAACGAGCGGCTGTCCTTGCTAA
CGGATGCCACTGAGGCTCAGGAGGAGATTCGAGAGGCTGCCCTGGGCATA
TCATCATTTATTGATCAGTGTTTGGTCCTGACGGAGGCCGTGGACTTTTT
CAACTGCTTTGCCAAAATGGCTAAGTTACAGTTGGCGAATGTCTACAGTA
TATCATTTAATGCCACCGAGCAGGCTTTAATCCTAAATAAGAAATTAAGT
AGAATCGAATTGGAGCACTATCGCTGCACAAATCAAACCGAACAAAATTA
TGTCAAAGGAACCAATACAATCTTTCGATCTTTGGATCAGTGTCTGCAGC
AAAATGATACACACTGAGTTGAACATTAATAAATATTTATTGTACTTCCA
TGTATAATATAACTTAAAAAAAAAAAAAAAAAA

FI16813.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13935341..13935666 45..370 1525 97.9 Plus
chr2R 21145070 chr2R 13935721..13935967 369..615 1145 97.6 Plus
chr2R 21145070 chr2R 13935245..13935290 1..46 230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18048222..18048547 45..370 1630 100 Plus
2R 25286936 2R 18048602..18048850 369..617 1245 100 Plus
2R 25286936 2R 18048126..18048171 1..46 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18049421..18049746 45..370 1630 100 Plus
2R 25260384 2R 18049801..18050049 369..617 1245 100 Plus
2R 25260384 2R 18049325..18049370 1..46 230 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:25:43 has no hits.

FI16813.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:25 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13935342..13935665 46..369 97 -> Plus
chr2R 13935245..13935289 1..45 100 -> Plus
chr2R 13935722..13935967 370..615 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:33 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
CG34005-RB 1..558 10..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:50 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
CG34005-RB 1..558 10..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:53 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
CG34005-RB 1..558 10..567 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:33 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
CG34005-RB 15..629 1..615 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:50 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
CG34005-RB 19..633 1..615 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:53 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
CG34005-RB 19..633 1..615 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:25 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18048126..18048170 1..45 100 -> Plus
2R 18048223..18048546 46..369 100 -> Plus
2R 18048603..18048848 370..615 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:25 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18048126..18048170 1..45 100 -> Plus
2R 18048223..18048546 46..369 100 -> Plus
2R 18048603..18048848 370..615 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:25 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18048126..18048170 1..45 100 -> Plus
2R 18048223..18048546 46..369 100 -> Plus
2R 18048603..18048848 370..615 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:50 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13935631..13935675 1..45 100 -> Plus
arm_2R 13935728..13936051 46..369 100 -> Plus
arm_2R 13936108..13936353 370..615 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:02 Download gff for FI16813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18049422..18049745 46..369 100 -> Plus
2R 18049802..18050047 370..615 100   Plus
2R 18049325..18049369 1..45 100 -> Plus

FI16813.pep Sequence

Translation from 0 to 566

> FI16813.pep
ISAMKTAIILLIALGACAAEPSPRTLNSFCSYLDDGKETVSSLGNTKKCF
ARYLPELESEGATWSQGYNACQKITINERLSLLTDATEAQEEIREAALGI
SSFIDQCLVLTEAVDFFNCFAKMAKLQLANVYSISFNATEQALILNKKLS
RIELEHYRCTNQTEQNYVKGTNTIFRSLDQCLQQNDTH*

FI16813.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11688-PA 135 GF11688-PA 1..135 54..188 497 64.4 Plus
Dana\GF13211-PA 249 GF13211-PA 41..186 38..183 189 33.3 Plus
Dana\GF13208-PA 377 GF13208-PA 34..187 29..183 177 26.9 Plus
Dana\GF24864-PA 250 GF24864-PA 61..194 49..182 162 29.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21837-PA 184 GG21837-PA 1..184 4..188 844 87 Plus
Dere\GG21000-PA 300 GG21000-PA 49..186 46..183 185 31.9 Plus
Dere\GG21002-PA 211 GG21002-PA 6..184 7..183 177 27.9 Plus
Dere\GG14514-PA 249 GG14514-PA 60..193 49..182 155 27.6 Plus
Dere\GG12014-PA 210 GG12014-PA 55..193 44..182 151 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21443-PA 174 GH21443-PA 2..168 19..187 394 46.2 Plus
Dgri\GH20454-PA 246 GH20454-PA 50..189 46..183 166 33.1 Plus
Dgri\GH15758-PA 256 GH15758-PA 14..192 9..182 155 25.1 Plus
Dgri\GH20448-PA 278 GH20448-PA 7..181 9..181 146 24.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34005-PC 185 CG34005-PC 1..185 4..188 950 100 Plus
CG34005-PB 185 CG34005-PB 1..185 4..188 950 100 Plus
CG5767-PA 253 CG5767-PA 1..186 4..183 223 30.6 Plus
CG5770-PA 213 CG5770-PA 7..184 8..183 208 27.9 Plus
CG10911-PA 359 CG10911-PA 7..185 7..182 171 24.4 Plus
CG16762-PA 254 CG16762-PA 64..197 49..182 164 26.9 Plus
CG7567-PA 211 CG7567-PA 55..193 44..182 150 27.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20246-PA 186 GI20246-PA 21..180 22..183 381 45.1 Plus
Dmoj\GI19281-PA 230 GI19281-PA 50..189 46..183 190 33.6 Plus
Dmoj\GI12536-PA 253 GI12536-PA 59..192 49..182 167 29.9 Plus
Dmoj\GI19278-PA 253 GI19278-PA 49..182 49..182 143 23.9 Plus
Dmoj\GI24462-PA 213 GI24462-PA 37..180 39..182 140 25 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11526-PA 186 GL11526-PA 6..186 8..188 532 53.5 Plus
Dper\GL10543-PA 256 GL10543-PA 50..187 46..183 179 31.2 Plus
Dper\GL24611-PA 258 GL24611-PA 65..198 49..182 174 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24760-PA 186 GA24760-PA 6..186 8..188 531 53.5 Plus
Dpse\GA19113-PA 256 GA19113-PA 50..187 46..183 181 31.2 Plus
Dpse\GA14134-PA 258 GA14134-PA 65..198 49..182 174 29.9 Plus
Dpse\GA26834-PA 218 GA26834-PA 50..186 46..182 143 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21839-PA 189 GM21839-PA 4..189 2..188 819 88.8 Plus
Dsec\GM19934-PA 253 GM19934-PA 41..186 38..183 179 31.5 Plus
Dsec\GM19935-PA 212 GM19935-PA 7..184 8..183 175 27.5 Plus
Dsec\GM19931-PA 366 GM19931-PA 8..185 8..182 149 24 Plus
Dsec\GM12239-PA 211 GM12239-PA 55..193 44..182 140 27.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11333-PA 190 GD11333-PA 4..190 2..188 870 92.5 Plus
Dsim\GD25424-PA 212 GD25424-PA 7..184 8..183 204 29.1 Plus
Dsim\GD25423-PA 253 GD25423-PA 1..186 4..183 185 32.1 Plus
Dsim\GD13390-PA 250 GD13390-PA 60..193 49..182 140 26.1 Plus
Dsim\GD17731-PA 199 GD17731-PA 43..181 44..182 139 27.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20200-PA 187 GJ20200-PA 1..177 4..183 430 48.3 Plus
Dvir\GJ22158-PA 248 GJ22158-PA 50..189 46..183 182 36.2 Plus
Dvir\GJ22155-PA 276 GJ22155-PA 49..182 49..182 162 26.9 Plus
Dvir\GJ16053-PA 252 GJ16053-PA 52..192 35..182 159 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22242-PA 168 GK22242-PA 17..162 38..183 389 47.9 Plus
Dwil\GK12510-PA 326 GK12510-PA 54..187 49..182 156 29.1 Plus
Dwil\GK22059-PA 340 GK22059-PA 4..179 5..183 155 26.3 Plus
Dwil\GK22063-PA 185 GK22063-PA 6..128 61..183 146 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11916-PA 184 GE11916-PA 1..183 4..187 822 85.9 Plus
Dyak\GE13943-PA 274 GE13943-PA 49..186 46..183 200 34.5 Plus
Dyak\GE13945-PA 211 GE13945-PA 7..184 8..183 174 29.1 Plus
Dyak\GE21706-PA 254 GE21706-PA 64..197 49..182 159 28.4 Plus
Dyak\GE10450-PA 211 GE10450-PA 56..194 44..182 151 30 Plus

FI16813.hyp Sequence

Translation from 0 to 566

> FI16813.hyp
ISAMKTAIILLIALGACAAEPSPRTLNSFCSYLDDGKETVSSLGNTKKCF
ARYLPELESEGATWSQGYNACQKITINERLSLLTDATEAQEEIREAALGI
SSFIDQCLVLTEAVDFFNCFAKMAKLQLANVYSISFNATEQALILNKKLS
RIELEHYRCTNQTEQNYVKGTNTIFRSLDQCLQQNDTH*

FI16813.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34005-PC 185 CG34005-PC 1..185 4..188 950 100 Plus
CG34005-PB 185 CG34005-PB 1..185 4..188 950 100 Plus
CG5767-PA 253 CG5767-PA 1..186 4..183 223 30.6 Plus
CG5770-PA 213 CG5770-PA 7..184 8..183 208 27.9 Plus
CG10911-PA 359 CG10911-PA 7..185 7..182 171 24.4 Plus