Clone FI16815 Report

Search the DGRC for FI16815

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:15
Vector:pOT2
Associated Gene/TranscriptCG33469-RA
Protein status:FI16815.pep: gold
Sequenced Size:649

Clone Sequence Records

FI16815.complete Sequence

649 bp assembled on 2011-11-23

GenBank Submission: BT132808.1

> FI16815.complete
CAAAATTGCCGCACACTTATCAATGGGCAAAGCCTATGAATCACCTTAAG
TTTTCATCTGATTATATTTCTTAATAGCAGGGAATATTAGCAACATGGAC
GATAAATTGGAAAAGTACTGGAGACGTCTATTTTATATGAAGTCAGTTGC
AGAACCTACGTCGTTGGATGCTGATACGATAGAATATTTCGGAATATTCA
GTATTGACGAACCAAATGTCGCTGCCCAAAAACGGTGGTACATTTATTAT
GGCCTTAGATTAGAAAGGTTAAAGGTTCTGGAAAGGATTCGAAAGAAATA
TGGCAATAGGAATGTCAGAGAAATATTTCAGATCGCCACATTCAGCGGAG
TGGGATTTCATAAAGTCGTCAGAGAATATTTCTCCAACTTAAAATGGTTC
ACAAGCAGAAATCAATTGGAAGCTCCACTAAATAGTTATTATAATGATGA
AAGACTAGTGAAAACTGTTTCGGACTTGCATAACAAGGAGCAAAAAAGAA
TCTTTGACTATATAATGATACAACACGCCTGGTTTGAGCGGTATAATGAT
CAAAAACCACCTCCTGCTAAACATTAAACTAACTAAAAACATCGACTTAC
AGTCGACATCTGTTGACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI16815.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10492955..10493572 618..1 3090 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14605648..14606269 622..1 3110 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14606847..14607468 622..1 3110 100 Minus
Blast to na_te.dros performed 2019-03-15 11:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 1980..2017 603..566 109 76.3 Minus

FI16815.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:34:54 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10492955..10493572 1..618 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 13:10:39 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
CG33469-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:46:20 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
CG33469-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:37:56 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
CG33469-RA 1..483 95..577 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 13:10:38 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
CG33469-RA 1..618 1..618 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:46:20 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
CG33469-RA 34..651 1..618 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:37:56 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
CG33469-RA 34..651 1..618 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:34:54 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14605652..14606269 1..618 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:34:54 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14605652..14606269 1..618 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:34:54 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14605652..14606269 1..618 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:46:20 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10493157..10493774 1..618 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:54 Download gff for FI16815.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14606851..14607468 1..618 100   Minus

FI16815.hyp Sequence

Translation from 94 to 576

> FI16815.hyp
MDDKLEKYWRRLFYMKSVAEPTSLDADTIEYFGIFSIDEPNVAAQKRWYI
YYGLRLERLKVLERIRKKYGNRNVREIFQIATFSGVGFHKVVREYFSNLK
WFTSRNQLEAPLNSYYNDERLVKTVSDLHNKEQKRIFDYIMIQHAWFERY
NDQKPPPAKH*

FI16815.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG33469-PB 160 CG33469-PB 1..160 1..160 858 100 Plus
CG33469-PA 160 CG33469-PA 1..160 1..160 858 100 Plus
CG12868-PB 167 CG12868-PB 17..166 1..150 349 39.3 Plus
CG33468-PA 172 CG33468-PA 16..156 1..141 294 36.2 Plus

FI16815.pep Sequence

Translation from 94 to 576

> FI16815.pep
MDDKLEKYWRRLFYMKSVAEPTSLDADTIEYFGIFSIDEPNVAAQKRWYI
YYGLRLERLKVLERIRKKYGNRNVREIFQIATFSGVGFHKVVREYFSNLK
WFTSRNQLEAPLNSYYNDERLVKTVSDLHNKEQKRIFDYIMIQHAWFERY
NDQKPPPAKH*

FI16815.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19839-PA 159 GF19839-PA 1..153 5..157 416 51.6 Plus
Dana\GF13527-PA 168 GF13527-PA 18..168 1..151 310 35.1 Plus
Dana\GF13526-PA 176 GF13526-PA 19..170 1..151 274 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22413-PA 160 GG22413-PA 1..160 1..160 729 83.8 Plus
Dere\GG22414-PA 163 GG22414-PA 15..162 3..150 344 40.5 Plus
Dere\GG16565-PA 133 GG16565-PA 2..126 4..150 227 30.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21117-PA 155 GH21117-PA 9..148 2..144 282 39.2 Plus
Dgri\GH21116-PA 156 GH21116-PA 10..149 2..144 256 36.4 Plus
Dgri\GH21115-PA 150 GH21115-PA 10..147 4..141 240 34.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG33469-PB 160 CG33469-PB 1..160 1..160 858 100 Plus
CG33469-PA 160 CG33469-PA 1..160 1..160 858 100 Plus
CG12868-PB 167 CG12868-PB 17..166 1..150 349 39.3 Plus
CG33468-PA 172 CG33468-PA 16..156 1..141 294 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18721-PA 141 GI18721-PA 1..139 12..150 298 40.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10638-PA 158 GL10638-PA 8..155 2..149 316 37.2 Plus
Dper\GL10639-PA 127 GL10639-PA 22..121 1..100 163 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11869-PA 138 GA11869-PA 1..135 15..149 308 39.3 Plus
Dpse\GA24429-PA 231 GA24429-PA 99..226 20..147 293 37.5 Plus
Dpse\GA24428-PA 178 GA24428-PA 22..170 1..149 263 33.6 Plus
Dpse\GA24429-PA 231 GA24429-PA 7..134 19..143 155 28.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20201-PA 160 GM20201-PA 1..160 1..160 793 93.1 Plus
Dsec\GM20202-PA 163 GM20202-PA 13..162 1..150 332 38 Plus
Dsec\GM20200-PA 172 GM20200-PA 16..155 1..140 278 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25672-PA 160 GD25672-PA 1..160 1..160 799 93.8 Plus
Dsim\GD25671-PA 172 GD25671-PA 16..156 1..141 290 37.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21739-PA 141 GJ21739-PA 1..139 12..150 314 43.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15732-PA 148 GK15732-PA 2..142 10..150 257 34.8 Plus
Dwil\GK15731-PA 137 GK15731-PA 1..132 15..146 251 32.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12302-PA 156 GE12302-PA 1..156 5..160 685 81.4 Plus
Dyak\GE12303-PA 163 GE12303-PA 13..161 1..149 324 37.6 Plus
Dyak\GE12301-PA 172 GE12301-PA 16..166 1..151 300 34.4 Plus