Clone FI16816 Report

Search the DGRC for FI16816

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:16
Vector:pOT2
Associated Gene/TranscriptVha16-3-RA
Protein status:FI16816.pep: gold
Sequenced Size:603

Clone Sequence Records

FI16816.complete Sequence

603 bp assembled on 2011-11-23

GenBank Submission: BT132829.1

> FI16816.complete
GTTTCTCAGAATCATAATCAAAATGGCAACAGATGCAGCTGACAAGGATA
AGCCGGCGTACTCGTTCTTCTTTGGTTCGATGGGAGCGGCATCGGCCATC
ATCTTTTCAGCCTTGGGAGCGGCATATGGAACGGCCAAGTCGGGCACTGG
GATTGCAGCCATGGCCGTAATGCGACCCGAATTGATCATGAAATCGATTA
TTCCCGTTGTGATGGCTGGTATCATTGCGATCTATGGCCTGGTGGTCTCC
GTTCTGATTGCCGGATCTCTGTCGGATTCGTATACCATTCGCAAGGGATA
CATCCACCTGGCAGCCGGATTATCGGTGGGTTTCGCCGGATTGGCGGCTG
GATTTGCCATTGGGATTGTGGGTGATGCCGGAGTGCGGGGCACTGCCCAG
CAGCCACGCCTTTTTGTGGGCATGATCCTGATCCTGATCTTCGCCGAGGT
ACTGGGTCTGTATGGGCTGATCGTCGCCATTTACCTGTACACCAAGTAAA
CTGCGTATTTTTTCACACTCAACAATGTTTTAGCCCTCATTAATGGGCAA
ATGTAAACTGAAATGTTTCATAATAAATGTTACATACAAAAAAAAAAAAA
AAA

FI16816.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11464204..11464790 1..587 2905 99.7 Plus
chr3L 24539361 chr3L 11465963..11466286 173..496 405 75 Plus
chr2R 21145070 chr2R 2514668..2514867 500..301 355 78.5 Minus
chr2R 21145070 chr2R 2514967..2515124 264..107 295 79.1 Minus
chr2L 23010047 chr2L 10735156..10735343 492..305 280 76.6 Minus
chr2R 21145070 chr2R 12834921..12835062 483..342 215 76.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11473386..11473976 1..591 2955 100 Plus
3L 28110227 3L 11475145..11475468 173..496 375 74.4 Plus
2R 25286936 2R 6627469..6627668 500..301 355 78.5 Minus
2R 25286936 2R 6627768..6627925 264..107 295 79.1 Minus
2L 23513712 2L 10736392..10736579 492..305 280 76.6 Minus
2R 25286936 2R 16947727..16947868 483..342 215 76.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11466486..11467076 1..591 2955 100 Plus
2R 25260384 2R 6628668..6628867 500..301 355 78.5 Minus
3L 28103327 3L 11468428..11468568 356..496 330 82.2 Plus
2R 25260384 2R 6628967..6629124 264..107 295 79.1 Minus
2L 23513712 2L 10736392..10736501 492..383 250 81.8 Minus
2R 25260384 2R 16948926..16949067 483..342 215 76.7 Minus
3L 28103327 3L 11468245..11468339 173..267 190 80 Plus
Blast to na_te.dros performed on 2019-03-15 11:28:37 has no hits.

FI16816.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:29:55 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11464204..11464790 1..587 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:09:30 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-3-RB 1..477 23..499 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:49 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-3-RA 1..477 23..499 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:41 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-3-RA 1..477 23..499 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:09:30 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-3-RA 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:49 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-3-RA 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:41 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-3-RA 1..587 1..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:55 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11473386..11473972 1..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:55 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11473386..11473972 1..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:55 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11473386..11473972 1..587 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:49 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11466486..11467072 1..587 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:19 Download gff for FI16816.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11466486..11467072 1..587 100   Plus

FI16816.hyp Sequence

Translation from 0 to 498

> FI16816.hyp
FLRIIIKMATDAADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTG
IAAMAVMRPELIMKSIIPVVMAGIIAIYGLVVSVLIAGSLSDSYTIRKGY
IHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV
LGLYGLIVAIYLYTK*

FI16816.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-3-PB 158 CG32090-PB 1..158 8..165 767 100 Plus
Vha16-3-PA 158 CG32090-PA 1..158 8..165 767 100 Plus
Vha16-1-PB 159 CG3161-PB 8..159 16..165 634 86.2 Plus
Vha16-1-PA 159 CG3161-PA 8..159 16..165 634 86.2 Plus
Vha16-1-PD 159 CG3161-PD 8..159 16..165 634 86.2 Plus

FI16816.pep Sequence

Translation from 1 to 498

> FI16816.pep
FLRIIIKMATDAADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTG
IAAMAVMRPELIMKSIIPVVMAGIIAIYGLVVSVLIAGSLSDSYTIRKGY
IHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV
LGLYGLIVAIYLYTK*

FI16816.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25265-PA 157 GF25265-PA 2..157 10..165 708 92.9 Plus
Dana\GF13808-PA 159 GF13808-PA 2..159 10..165 629 83.5 Plus
Dana\GF19671-PA 180 GF19671-PA 23..176 13..164 537 69.5 Plus
Dana\GF25266-PA 159 GF25266-PA 6..157 14..165 492 74.3 Plus
Dana\GF13441-PA 202 GF13441-PA 10..138 11..139 410 62.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15504-PA 158 GG15504-PA 1..158 8..165 736 95.6 Plus
Dere\GG10820-PA 159 GG10820-PA 2..159 10..165 626 82.9 Plus
Dere\GG15505-PA 158 GG15505-PA 7..157 15..165 587 78.1 Plus
Dere\GG10362-PA 191 GG10362-PA 30..187 9..164 520 69.6 Plus
Dere\GG22236-PA 158 GG22236-PA 9..158 16..165 497 64.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16652-PA 161 GH16652-PA 3..161 7..165 700 90.6 Plus
Dgri\GH12724-PA 161 GH12724-PA 3..161 7..165 700 90.6 Plus
Dgri\GH22892-PA 161 GH22892-PA 3..161 9..165 635 84.3 Plus
Dgri\GH16653-PA 159 GH16653-PA 1..158 8..165 588 77.2 Plus
Dgri\GH10920-PA 173 GH10920-PA 22..171 18..165 583 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-3-PB 158 CG32090-PB 1..158 8..165 767 100 Plus
Vha16-3-PA 158 CG32090-PA 1..158 8..165 767 100 Plus
Vha16-1-PB 159 CG3161-PB 8..159 16..165 634 86.2 Plus
Vha16-1-PA 159 CG3161-PA 8..159 16..165 634 86.2 Plus
Vha16-1-PD 159 CG3161-PD 8..159 16..165 634 86.2 Plus
Vha16-1-PC 159 CG3161-PC 8..159 16..165 634 86.2 Plus
Vha16-2-PA 158 CG32089-PA 4..157 12..165 582 76 Plus
Vha16-5-PA 193 CG6737-PA 41..189 18..164 532 72.5 Plus
Vha16-4-PA 155 CG9013-PA 6..155 16..165 515 66 Plus
VhaPPA1-2-PB 212 CG7026-PB 51..207 22..165 242 34.4 Plus
VhaPPA1-1-PB 212 CG7007-PB 49..205 22..165 231 31.6 Plus
VhaPPA1-1-PA 212 CG7007-PA 49..205 22..165 231 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11612-PA 158 GI11612-PA 1..158 8..165 695 89.2 Plus
Dmoj\GI21278-PA 159 GI21278-PA 2..159 10..165 626 82.9 Plus
Dmoj\GI11613-PA 158 GI11613-PA 5..157 13..165 554 71.9 Plus
Dmoj\GI13313-PA 175 GI13313-PA 13..173 7..165 554 70.8 Plus
Dmoj\GI22996-PA 207 GI22996-PA 46..202 22..165 192 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21511-PA 162 GL21511-PA 11..162 14..165 687 92.8 Plus
Dper\GL20293-PA 159 GL20293-PA 2..159 10..165 630 84.2 Plus
Dper\GL10498-PA 165 GL10498-PA 13..165 13..165 554 75.2 Plus
Dper\GL10499-PA 165 GL10499-PA 13..165 13..165 554 75.2 Plus
Dper\GL26032-PA 182 GL26032-PA 20..179 7..164 550 73.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26304-PA 162 GA26304-PA 10..162 13..165 688 92.2 Plus
Dpse\GA16335-PA 159 GA16335-PA 2..159 10..165 630 84.2 Plus
Dpse\GA21477-PA 165 GA21477-PA 13..165 13..165 555 75.2 Plus
Dpse\GA25245-PA 182 GA25245-PA 20..179 7..164 550 73.1 Plus
Dpse\GA26306-PA 159 GA26306-PA 7..158 14..165 506 78.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25273-PA 158 GM25273-PA 1..158 8..165 763 100 Plus
Dsec\GM20869-PA 159 GM20869-PA 2..159 10..165 626 82.9 Plus
Dsec\GM25274-PA 158 GM25274-PA 4..157 12..165 572 75.3 Plus
Dsec\GM11483-PA 191 GM11483-PA 27..187 7..164 517 68.3 Plus
Dsec\GM20023-PA 158 GM20023-PA 1..158 8..165 514 63.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14307-PA 158 GD14307-PA 1..158 8..165 763 100 Plus
Dsim\GD10321-PA 159 GD10321-PA 2..159 10..165 626 82.9 Plus
Dsim\GD14308-PA 165 GD14308-PA 4..164 12..165 525 69.6 Plus
Dsim\GD22230-PA 191 GD22230-PA 27..187 7..164 518 68.3 Plus
Dsim\GD25509-PA 158 GD25509-PA 1..158 8..165 514 63.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11291-PA 159 GJ11291-PA 1..159 8..165 692 90.6 Plus
Dvir\GJ20880-PA 158 GJ20880-PA 2..158 11..165 637 86 Plus
Dvir\GJ11292-PA 159 GJ11292-PA 1..158 8..165 597 75.9 Plus
Dvir\GJ11943-PA 179 GJ11943-PA 28..177 18..165 566 76.7 Plus
Dvir\GJ24692-PA 212 GJ24692-PA 49..205 22..165 188 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17170-PA 160 GK17170-PA 9..160 14..165 712 96.7 Plus
Dwil\GK19648-PA 159 GK19648-PA 2..159 10..165 633 84.2 Plus
Dwil\GK17171-PA 160 GK17171-PA 1..159 8..165 602 79.9 Plus
Dwil\GK18316-PA 184 GK18316-PA 32..180 18..164 570 78.5 Plus
Dwil\GK22034-PA 160 GK22034-PA 8..160 13..165 550 74.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21812-PA 158 GE21812-PA 1..158 8..165 740 96.8 Plus
Dyak\Vha16-PA 159 GE24687-PA 2..159 10..165 626 82.9 Plus
Dyak\GE21813-PA 158 GE21813-PA 7..157 15..165 573 76.2 Plus
Dyak\GE14233-PA 158 GE14233-PA 1..158 8..165 508 62.7 Plus
Dyak\GE13384-PA 191 GE13384-PA 31..187 10..164 480 70.1 Plus