Clone FI16832 Report

Search the DGRC for FI16832

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:32
Vector:pOT2
Associated Gene/TranscriptCG34106-RA
Protein status:FI16832.pep: gold
Sequenced Size:582

Clone Sequence Records

FI16832.complete Sequence

582 bp assembled on 2011-11-23

GenBank Submission: BT132802.1

> FI16832.complete
TTTGCGTCTCACACACACCGTTTCGTTAGTTTGTTAAAAAAGAACTTACA
CATCCTAGTTTAAGTCAGATGTATGACCAGGTGATATTCACAGCTGAACT
CTTGCACCACAGAACTGTGGGCAGCCAAATCGAGGAGACACGGCGCCATT
GGGAGGAGCGGTGCTCTTGGTTTCCGGCTGCCCAAAGGAATATGGCATCA
AGGTGTTCAGAAATTTACAAGGAGAGTCTTGAAAAATACGGCAACGATTA
CTACGAGTTCTATGCCAATAGGAATCGTCTGAAGGAAGAACACAGAGTTA
ATACCAAGTCTTATAAACGTCGGGAAAGAAGAAGGTCCCACAGGCCAATG
GACCACTTAAAAGACTATAGGGTGTCACCAACTTCAAACGGGGAGTACGG
AAGTGTTCGGCCAATGCTTCTCCTTCAATGGCTTTAGAAAACTGAAAGCA
TAAAATTTTAAAGTTTGAAAAAATAGTATGATAGTATAAATAAACATGTA
AGCAACCTTACGGAGATAAGGTGTATTGACCTTAAATAAAACAAACTGTA
GAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAA

FI16832.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17170080..17170635 1..556 2780 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17171412..17171972 1..561 2805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17171412..17171972 1..561 2805 100 Plus
Blast to na_te.dros performed 2019-03-15 11:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 3012..3140 427..555 123 57.3 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 1081..1145 433..496 115 66.2 Plus

FI16832.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:29:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17170080..17170635 1..556 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:09:31 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 1..369 69..437 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 1..369 69..437 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:47 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 1..369 69..437 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:09:31 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 6..561 1..556 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 1..556 1..556 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:47 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34106-RA 1..556 1..556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17171412..17171967 1..556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17171412..17171967 1..556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17171412..17171967 1..556 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:58 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17171412..17171967 1..556 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:20 Download gff for FI16832.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17171412..17171967 1..556 100   Plus

FI16832.pep Sequence

Translation from 68 to 436

> FI16832.pep
MYDQVIFTAELLHHRTVGSQIEETRRHWEERCSWFPAAQRNMASRCSEIY
KESLEKYGNDYYEFYANRNRLKEEHRVNTKSYKRRERRRSHRPMDHLKDY
RVSPTSNGEYGSVRPMLLLQWL*

FI16832.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14786-PA 124 GF14786-PA 4..124 2..122 397 59.5 Plus
Dana\GF14787-PA 130 GF14787-PA 3..121 1..119 317 50.4 Plus
Dana\GF11537-PA 123 GF11537-PA 1..120 1..118 148 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21075-PA 124 GG21075-PA 4..121 2..119 253 43.2 Plus
Dere\GG23008-PA 121 GG23008-PA 1..115 1..115 152 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20361-PA 119 GH20361-PA 5..113 5..115 135 29.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34106-PB 122 CG34106-PB 1..122 1..122 665 100 Plus
CG34106-PA 122 CG34106-PA 1..122 1..122 665 100 Plus
CG34169-PA 124 CG34169-PA 4..120 2..118 296 49.6 Plus
CG3611-PB 121 CG3611-PB 5..118 5..118 164 29.8 Plus
CG3611-PC 121 CG3611-PC 5..118 5..118 164 29.8 Plus
CG3611-PA 121 CG3611-PA 5..118 5..118 164 29.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14285-PA 139 GI14285-PA 6..121 1..115 212 39.7 Plus
Dmoj\GI20033-PA 121 GI20033-PA 5..115 5..115 164 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22399-PA 122 GL22399-PA 4..115 3..115 295 52.2 Plus
Dper\GL16776-PA 119 GL16776-PA 5..113 7..115 172 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28933-PA 122 GA28933-PA 4..115 3..115 295 52.2 Plus
Dpse\GA17557-PA 119 GA17557-PA 5..113 7..115 164 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11902-PA 121 GM11902-PA 1..115 1..115 158 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11899-PA 121 GD11899-PA 1..115 1..115 158 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21276-PA 121 GJ21276-PA 4..115 4..115 169 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19082-PA 129 GK19082-PA 1..122 1..119 212 39.3 Plus
Dwil\GK21674-PA 121 GK21674-PA 5..118 5..118 144 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14445-PA 121 GE14445-PA 1..115 1..115 159 30.4 Plus

FI16832.hyp Sequence

Translation from 68 to 436

> FI16832.hyp
MYDQVIFTAELLHHRTVGSQIEETRRHWEERCSWFPAAQRNMASRCSEIY
KESLEKYGNDYYEFYANRNRLKEEHRVNTKSYKRRERRRSHRPMDHLKDY
RVSPTSNGEYGSVRPMLLLQWL*

FI16832.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34106-PB 122 CG34106-PB 1..122 1..122 665 100 Plus
CG34106-PA 122 CG34106-PA 1..122 1..122 665 100 Plus
CG34169-PA 124 CG34169-PA 4..120 2..118 296 49.6 Plus
CG3611-PB 121 CG3611-PB 5..118 5..118 164 29.8 Plus
CG3611-PC 121 CG3611-PC 5..118 5..118 164 29.8 Plus