Clone FI16837 Report

Search the DGRC for FI16837

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:37
Vector:pOT2
Associated Gene/TranscriptCG42718-RA
Protein status:FI16837.pep: gold
Sequenced Size:369

Clone Sequence Records

FI16837.complete Sequence

369 bp assembled on 2011-11-23

GenBank Submission: BT132801.1

> FI16837.complete
TTTCGCCGAGCCAAATTCAAACTAAGACTAGATCCAATTTCAGCTGCCTC
AACATGCACAGAATGCTGCTCTACACTTTGGTAATCGTTGCCCTTGCTTT
GGTTCAGGCCTGCCAAATCCATCATAATCTGACATTTCCTGCTGTGGACC
AAGTTTCCGACTGTTCTGGCCACTACCTCACTTTTGGTAATCGGAGTTTG
ACAAGGGATCTGCCCACATTAACCCCAGGCAATTCGATGTCATCTCGGCT
TGAACTTTGCTTTTATGGCAAACCTTTTACGCTGGGGCATTAGCCGTGCA
TTGTTGTTGCTTTGTTATTGCTTGAATAAATTGTTGTAAATTATTAATTA
TAAAAAAAAAAAAAAAAAA

FI16837.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16310580..16310866 351..65 1435 100 Minus
chr3L 24539361 chr3L 16310958..16311022 65..1 325 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16320825..16321116 356..65 1445 99.7 Minus
3L 28110227 3L 16321208..16321272 65..1 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16313925..16314216 356..65 1445 99.6 Minus
3L 28103327 3L 16314308..16314372 65..1 325 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:30:14 has no hits.

FI16837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:31:19 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16310580..16310865 66..351 100 <- Minus
chr3L 16310958..16311022 1..65 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:46:08 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 1..240 54..293 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:35 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 1..240 54..293 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:45 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 1..240 54..293 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:46:08 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 1..351 1..351 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:35 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 1..351 1..351 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:45 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 1..351 1..351 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:19 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16320830..16321115 66..351 100 <- Minus
3L 16321208..16321272 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:19 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16320830..16321115 66..351 100 <- Minus
3L 16321208..16321272 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:19 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16320830..16321115 66..351 100 <- Minus
3L 16321208..16321272 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:35 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16313930..16314215 66..351 100 <- Minus
arm_3L 16314308..16314372 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:28 Download gff for FI16837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16313930..16314215 66..351 100 <- Minus
3L 16314308..16314372 1..65 100   Minus

FI16837.hyp Sequence

Translation from 2 to 292

> FI16837.hyp
SPSQIQTKTRSNFSCLNMHRMLLYTLVIVALALVQACQIHHNLTFPAVDQ
VSDCSGHYLTFGNRSLTRDLPTLTPGNSMSSRLELCFYGKPFTLGH*

FI16837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-PA 79 CG42718-PA 1..79 18..96 421 100 Plus

FI16837.pep Sequence

Translation from 2 to 292

> FI16837.pep
SPSQIQTKTRSNFSCLNMHRMLLYTLVIVALALVQACQIHHNLTFPAVDQ
VSDCSGHYLTFGNRSLTRDLPTLTPGNSMSSRLELCFYGKPFTLGH*

FI16837.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-PA 79 CG42718-PA 1..79 18..96 421 100 Plus