Clone FI16840 Report

Search the DGRC for FI16840

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:40
Vector:pOT2
Associated Gene/TranscriptCG14958-RA
Protein status:FI16840.pep: gold
Sequenced Size:571

Clone Sequence Records

FI16840.complete Sequence

571 bp assembled on 2011-11-23

GenBank Submission: BT132796.1

> FI16840.complete
CCCCGCAGTTGTTAAGATGTACAAATTACTCGGTTTGATTGCCTTGGTGG
CCTTTCCAATCGCTTGGATCCAGGCAGACTGTAATGTATGCCAGTCAAAT
GGAGCCTCCTGCATCAACCAGACCGCATACAATTTGTGCTTCGGCTCCAC
TCAGCCGAATACCAACCAAACCTTCGTCTGCACGGATGGCCTGGTGTGCA
CGGACCAGCCAGTGATCTGTTTCCAGAGGGGCGAGAATCCCGCCAGTTGC
GGCGACACTGATAGCTGTGGCCAGTGTGCTCCCAACTACACCTTCGCCTG
CACCTCGCGCTCAACCTTCGCCTTCTGCTTTGGCGCCATAACGCCCACAA
ATGTGACGGGCAGTTGCCCGGATGGTTACTTCTGTGACGCCTCCACCCAG
GAGATCTGCGTCACCAAGGCCACTGATGACTCCATCATCTGCCACTTGAA
TTAGCCTCGCTAATTATTGGATATAAATAAATGATTTTGCCTAATAATAT
ATTGCTTTTGTTATTAAATAAAATTCGTTTTGGGTAAATGGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

FI16840.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3189533..3190037 37..541 2465 99.2 Plus
chr3L 24539361 chr3L 3189392..3189428 1..37 185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3190119..3190624 37..542 2530 100 Plus
3L 28110227 3L 3189978..3190014 1..37 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3190119..3190624 37..542 2530 100 Plus
3L 28103327 3L 3189978..3190014 1..37 185 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:30:25 has no hits.

FI16840.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:31:25 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3189392..3189428 1..37 100 -> Plus
chr3L 3189534..3190037 38..541 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:46:09 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
CG14958-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:42 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
CG14958-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:58 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
CG14958-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:46:09 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
CG14958-RA 1..525 17..541 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:42 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
CG14958-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:58 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
CG14958-RA 1..541 1..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:25 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3189978..3190014 1..37 100 -> Plus
3L 3190120..3190623 38..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:25 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3189978..3190014 1..37 100 -> Plus
3L 3190120..3190623 38..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:25 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3189978..3190014 1..37 100 -> Plus
3L 3190120..3190623 38..541 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:42 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3189978..3190014 1..37 100 -> Plus
arm_3L 3190120..3190623 38..541 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:29 Download gff for FI16840.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3190120..3190623 38..541 100   Plus
3L 3189978..3190014 1..37 100 -> Plus

FI16840.hyp Sequence

Translation from 0 to 453

> FI16840.hyp
PAVVKMYKLLGLIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGST
QPNTNQTFVCTDGLVCTDQPVICFQRGENPASCGDTDSCGQCAPNYTFAC
TSRSTFAFCFGAITPTNVTGSCPDGYFCDASTQEICVTKATDDSIICHLN
*

FI16840.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14958-PA 145 CG14958-PA 1..145 6..150 812 100 Plus
CG34427-PB 269 CG34427-PB 11..154 11..150 359 46.5 Plus
CG13309-PA 229 CG13309-PA 1..129 9..141 245 36.6 Plus
CG13311-PA 153 CG13311-PA 10..147 10..147 231 37.5 Plus
CG13308-PB 233 CG13308-PB 7..141 9..147 217 33.6 Plus

FI16840.pep Sequence

Translation from 1 to 453

> FI16840.pep
PAVVKMYKLLGLIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGST
QPNTNQTFVCTDGLVCTDQPVICFQRGENPASCGDTDSCGQCAPNYTFAC
TSRSTFAFCFGAITPTNVTGSCPDGYFCDASTQEICVTKATDDSIICHLN
*

FI16840.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10121-PA 147 GF10121-PA 1..147 6..150 620 78.9 Plus
Dana\GF24357-PA 272 GF24357-PA 5..154 3..150 312 42.4 Plus
Dana\GF24356-PA 320 GF24356-PA 1..145 4..145 189 37.5 Plus
Dana\GF24359-PA 230 GF24359-PA 1..126 9..137 183 36.6 Plus
Dana\GF20111-PA 145 GF20111-PA 13..127 23..139 159 37.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15111-PA 148 GG15111-PA 16..148 18..150 667 96.2 Plus
Dere\GG14349-PA 505 GG14349-PA 261..367 47..150 214 43 Plus
Dere\GG14353-PA 229 GG14353-PA 1..129 9..141 193 35.1 Plus
Dere\GG15057-PA 154 GG15057-PA 5..137 5..137 190 38.1 Plus
Dere\GG15056-PA 158 GG15056-PA 5..140 5..139 164 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10924-PA 155 GH10924-PA 3..148 5..150 441 56.8 Plus
Dgri\GH15329-PA 430 GH15329-PA 243..345 51..150 225 42.7 Plus
Dgri\GH16136-PA 333 GH16136-PA 22..135 23..136 144 35.7 Plus
Dgri\GH15329-PA 430 GH15329-PA 7..134 4..135 142 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14958-PA 145 CG14958-PA 1..145 6..150 812 100 Plus
CG34427-PB 269 CG34427-PB 11..154 11..150 359 46.5 Plus
CG13309-PA 229 CG13309-PA 1..129 9..141 245 36.6 Plus
CG13311-PA 153 CG13311-PA 10..147 10..147 231 37.5 Plus
CG13308-PB 233 CG13308-PB 7..141 9..147 217 33.6 Plus
CG32023-PA 160 CG32023-PA 5..138 5..137 211 34.3 Plus
CG34426-PA 296 CG34426-PA 6..142 12..147 188 33.8 Plus
CG13312-PA 342 CG13312-PA 10..141 16..136 165 30.3 Plus
CG32024-PA 209 CG32024-PA 5..139 9..147 157 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13368-PA 149 GI13368-PA 7..149 9..150 451 61.5 Plus
Dmoj\GI12931-PA 304 GI12931-PA 41..174 20..150 308 45.5 Plus
Dmoj\GI12405-PA 343 GI12405-PA 7..135 8..136 162 35.6 Plus
Dmoj\GI12935-PA 216 GI12935-PA 17..124 24..136 145 36.2 Plus
Dmoj\GI12406-PA 156 GI12406-PA 6..138 12..138 144 31.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24894-PA 143 GL24894-PA 1..138 6..150 563 75.9 Plus
Dper\GL10343-PA 228 GL10343-PA 14..154 13..150 325 45.4 Plus
Dper\GL10345-PA 237 GL10345-PA 1..138 6..147 139 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13383-PA 150 GA13383-PA 1..145 6..150 563 76.6 Plus
Dpse\GA28198-PA 466 GA28198-PA 257..395 15..150 316 45.3 Plus
Dpse\GA12192-PA 156 GA12192-PA 5..140 5..137 191 34.5 Plus
Dpse\GA12188-PA 237 GA12188-PA 1..138 6..147 138 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14547-PA 145 GM14547-PA 1..145 6..150 731 97.2 Plus
Dsec\GM25094-PA 245 GM25094-PA 2..135 20..150 300 46.3 Plus
Dsec\GM25097-PA 229 GM25097-PA 1..129 9..141 184 35.1 Plus
Dsec\GM24914-PA 153 GM24914-PA 5..136 5..137 183 38.4 Plus
Dsec\GM24913-PA 168 GM24913-PA 5..140 5..139 173 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13738-PA 145 GD13738-PA 1..145 6..150 736 97.2 Plus
Dsim\GD14128-PA 473 GD14128-PA 267..358 62..150 192 45.7 Plus
Dsim\GD14131-PA 229 GD14131-PA 1..129 9..141 186 35.1 Plus
Dsim\GD12961-PA 153 GD12961-PA 5..136 5..137 183 38.4 Plus
Dsim\GD14130-PA 225 GD14130-PA 1..141 3..147 183 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12008-PA 149 GJ12008-PA 8..149 10..150 471 65.5 Plus
Dvir\GJ13074-PA 420 GJ13074-PA 252..353 52..150 240 49 Plus
Dvir\GJ13075-PA 245 GJ13075-PA 1..131 6..141 152 33.6 Plus
Dvir\GJ12295-PA 362 GJ12295-PA 3..134 4..136 147 33.8 Plus
Dvir\GJ13076-PA 239 GJ13076-PA 18..138 24..149 145 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13204-PA 148 GK13204-PA 1..148 6..150 559 74.5 Plus
Dwil\GK16739-PA 488 GK16739-PA 277..378 52..150 210 44.1 Plus
Dwil\GK17468-PA 151 GK17468-PA 5..147 5..148 187 33.6 Plus
Dwil\GK17466-PA 337 GK17466-PA 2..139 6..140 164 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21338-PA 148 GE21338-PA 20..147 22..149 626 93.8 Plus
Dyak\GE20782-PA 266 GE20782-PA 11..154 11..150 323 47.2 Plus
Dyak\GE20785-PA 229 GE20785-PA 16..129 24..141 169 37 Plus
Dyak\GE21281-PA 154 GE21281-PA 24..137 24..137 167 40.8 Plus
Dyak\GE21280-PA 160 GE21280-PA 5..140 5..139 166 32.4 Plus