BDGP Sequence Production Resources |
Search the DGRC for FI16843
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 168 |
Well: | 43 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15919-RA |
Protein status: | FI16843.pep: gold |
Sequenced Size: | 458 |
458 bp assembled on 2011-11-23
GenBank Submission: BT132804.1
> FI16843.complete AAACATGAAAGCGGCGAAAAGTGGCGACAGGATGGCGTATCCATGGATTA AAATGAGGCCCCTGCTGATGCTGACAGTAATATTGGTCATTTTCTTCAGC TACGGCCTGGCCGGCAAGACGACCACCATCGTTAGCCACACAGACACCCT CGATCCGCAGGCCGATGGCTTCTGGGTCAACAAGACGACGTGGAACGCTC GCTGGGTAAAGTACTGGCGGGCCAAGAAGATCTACGAGCCGGTGTGGAAA AAGGTCTGGACACCCACCATTCACAACGAGTGGGTGCCCTTGCCCAATGT GCCCAATGAATGGGAGGCGGAAAAGGATCGCTCCTAAAAATAGCACTGAG ACTGAAACATAGGCTAAGATTATTTATGGTTTAGTTGTTTATATTTTATT TTATATTCACTGGTAATTAAAGTCTAGAGATAATTTAAAAAAAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
copia | 5143 | copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). | 178..235 | 412..355 | 118 | 71.2 | Minus |
copia | 5143 | copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). | 5047..5104 | 412..355 | 118 | 71.2 | Minus |
transib1 | 2167 | transib1 TRANSIB1 2167bp | 1844..1920 | 335..408 | 115 | 66.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12679840..12679968 | 1..129 | 98 | -> | Plus |
chr2R | 12680060..12680366 | 130..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15919-RA | 1..333 | 5..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15919-RA | 1..333 | 5..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15919-RA | 1..333 | 5..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15919-RA | 1..333 | 5..337 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15919-RA | 12..447 | 1..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15919-RA | 12..447 | 1..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16792653..16792781 | 1..129 | 100 | -> | Plus |
2R | 16792873..16793179 | 130..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16792653..16792781 | 1..129 | 100 | -> | Plus |
2R | 16792873..16793179 | 130..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16792653..16792781 | 1..129 | 100 | -> | Plus |
2R | 16792873..16793179 | 130..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12680158..12680286 | 1..129 | 100 | -> | Plus |
arm_2R | 12680378..12680684 | 130..436 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16794072..16794378 | 130..436 | 100 | Plus | |
2R | 16793852..16793980 | 1..129 | 100 | -> | Plus |
Translation from 0 to 336
> FI16843.hyp NMKAAKSGDRMAYPWIKMRPLLMLTVILVIFFSYGLAGKTTTIVSHTDTL DPQADGFWVNKTTWNARWVKYWRAKKIYEPVWKKVWTPTIHNEWVPLPNV PNEWEAEKDRS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15919-PA | 110 | CG15919-PA | 1..110 | 2..111 | 617 | 100 | Plus |
Translation from 1 to 336
> FI16843.pep NMKAAKSGDRMAYPWIKMRPLLMLTVILVIFFSYGLAGKTTTIVSHTDTL DPQADGFWVNKTTWNARWVKYWRAKKIYEPVWKKVWTPTIHNEWVPLPNV PNEWEAEKDRS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11411-PA | 103 | GF11411-PA | 7..102 | 16..111 | 381 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20631-PA | 96 | GG20631-PA | 1..94 | 18..111 | 466 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20367-PA | 114 | GH20367-PA | 35..110 | 35..108 | 297 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15919-PA | 110 | CG15919-PA | 1..110 | 2..111 | 617 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20040-PA | 116 | GI20040-PA | 17..110 | 21..110 | 307 | 62.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17737-PA | 117 | GL17737-PA | 1..114 | 2..111 | 346 | 65.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14026-PA | 117 | GA14026-PA | 1..114 | 2..111 | 354 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21725-PA | 96 | GM21725-PA | 1..94 | 18..111 | 437 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11220-PA | 100 | GD11220-PA | 1..96 | 11..111 | 407 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21284-PA | 127 | GJ21284-PA | 41..119 | 35..111 | 309 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21521-PA | 72 | GK21521-PA | 30..60 | 36..66 | 143 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11821-PA | 96 | GE11821-PA | 1..94 | 18..111 | 465 | 93.6 | Plus |