Clone FI16843 Report

Search the DGRC for FI16843

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:168
Well:43
Vector:pOT2
Associated Gene/TranscriptCG15919-RA
Protein status:FI16843.pep: gold
Sequenced Size:458

Clone Sequence Records

FI16843.complete Sequence

458 bp assembled on 2011-11-23

GenBank Submission: BT132804.1

> FI16843.complete
AAACATGAAAGCGGCGAAAAGTGGCGACAGGATGGCGTATCCATGGATTA
AAATGAGGCCCCTGCTGATGCTGACAGTAATATTGGTCATTTTCTTCAGC
TACGGCCTGGCCGGCAAGACGACCACCATCGTTAGCCACACAGACACCCT
CGATCCGCAGGCCGATGGCTTCTGGGTCAACAAGACGACGTGGAACGCTC
GCTGGGTAAAGTACTGGCGGGCCAAGAAGATCTACGAGCCGGTGTGGAAA
AAGGTCTGGACACCCACCATTCACAACGAGTGGGTGCCCTTGCCCAATGT
GCCCAATGAATGGGAGGCGGAAAAGGATCGCTCCTAAAAATAGCACTGAG
ACTGAAACATAGGCTAAGATTATTTATGGTTTAGTTGTTTATATTTTATT
TTATATTCACTGGTAATTAAAGTCTAGAGATAATTTAAAAAAAAAAAAAA
AAAAAAAA

FI16843.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12680056..12680366 126..436 1540 99.7 Plus
chr2R 21145070 chr2R 12679840..12679968 1..129 615 98.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16792869..16793182 126..439 1555 99.7 Plus
2R 25286936 2R 16792653..16792781 1..129 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16794068..16794381 126..439 1555 99.6 Plus
2R 25260384 2R 16793852..16793980 1..129 645 100 Plus
Blast to na_te.dros performed 2019-03-15 11:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 178..235 412..355 118 71.2 Minus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 5047..5104 412..355 118 71.2 Minus
transib1 2167 transib1 TRANSIB1 2167bp 1844..1920 335..408 115 66.2 Plus

FI16843.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:31:32 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12679840..12679968 1..129 98 -> Plus
chr2R 12680060..12680366 130..436 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:52:17 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 1..333 5..337 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:53 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 1..333 5..337 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:37:12 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 1..333 5..337 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:52:17 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 1..333 5..337 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:53 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 12..447 1..436 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:37:12 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 12..447 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:32 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16792653..16792781 1..129 100 -> Plus
2R 16792873..16793179 130..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:32 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16792653..16792781 1..129 100 -> Plus
2R 16792873..16793179 130..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:32 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16792653..16792781 1..129 100 -> Plus
2R 16792873..16793179 130..436 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:53 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12680158..12680286 1..129 100 -> Plus
arm_2R 12680378..12680684 130..436 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:47 Download gff for FI16843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16794072..16794378 130..436 100   Plus
2R 16793852..16793980 1..129 100 -> Plus

FI16843.hyp Sequence

Translation from 0 to 336

> FI16843.hyp
NMKAAKSGDRMAYPWIKMRPLLMLTVILVIFFSYGLAGKTTTIVSHTDTL
DPQADGFWVNKTTWNARWVKYWRAKKIYEPVWKKVWTPTIHNEWVPLPNV
PNEWEAEKDRS*

FI16843.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15919-PA 110 CG15919-PA 1..110 2..111 617 100 Plus

FI16843.pep Sequence

Translation from 1 to 336

> FI16843.pep
NMKAAKSGDRMAYPWIKMRPLLMLTVILVIFFSYGLAGKTTTIVSHTDTL
DPQADGFWVNKTTWNARWVKYWRAKKIYEPVWKKVWTPTIHNEWVPLPNV
PNEWEAEKDRS*

FI16843.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11411-PA 103 GF11411-PA 7..102 16..111 381 78.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20631-PA 96 GG20631-PA 1..94 18..111 466 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20367-PA 114 GH20367-PA 35..110 35..108 297 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15919-PA 110 CG15919-PA 1..110 2..111 617 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20040-PA 116 GI20040-PA 17..110 21..110 307 62.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17737-PA 117 GL17737-PA 1..114 2..111 346 65.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14026-PA 117 GA14026-PA 1..114 2..111 354 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21725-PA 96 GM21725-PA 1..94 18..111 437 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11220-PA 100 GD11220-PA 1..96 11..111 407 86.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21284-PA 127 GJ21284-PA 41..119 35..111 309 72.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21521-PA 72 GK21521-PA 30..60 36..66 143 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11821-PA 96 GE11821-PA 1..94 18..111 465 93.6 Plus