Clone FI16901 Report

Search the DGRC for FI16901

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:1
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG15641-RA
Protein status:FI16901.pep: gold
Sequenced Size:439

Clone Sequence Records

FI16901.complete Sequence

439 bp assembled on 2011-11-23

GenBank Submission: BT132827.1

> FI16901.complete
AGAGATCAACGGACTATGCGACGGCAAGGAGTGCATTGCTGCTGTCTGGT
GGCCATCGCCCTGGCCATGGCCATACGCCAGGTGTCCATGGGCATCAGCG
CCAGCGATCGCCGCTTCCAGTGCCTGCAGACGCGACTGATAGGCCAGGCC
AACTGCTCGCCATGCGCCGATCTGTACGTCTTCAATCGCCAATCCGCCTA
CCGGCGCTGCGAGCACGTCAACGGTAATTGCTACCCACATCGCACGGTCT
TCGCCAGCGCCCGCATGTGCGAGCTCACCTGCCAGCCGTACATCCGGCGA
CCCACGCTGCACGAGGTGACCACCCTGCCGCCGCCACCACCGATCGTCGA
GCCCTTCGGCGACAGCGATGAGGAGTTCGAGTGAGGTTTTGTCAACAAAG
ATAAGCTGCTTTTAAAAAAAAAAAAAAAAAAAAAAAAAA

FI16901.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15357827..15358239 1..413 2065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15467891..15468305 1..415 2075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15475989..15476403 1..415 2075 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:26:33 has no hits.

FI16901.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:27:42 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15357827..15358239 1..413 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:34 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15641-RA 1..369 16..384 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:58 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15641-RA 1..369 16..384 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:34:07 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15641-RA 1..369 16..384 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:34 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15641-RA 1..413 1..413 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:58 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15641-RA 1..413 1..413 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:34:07 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15641-RA 1..413 1..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:42 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
X 15467891..15468303 1..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:42 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
X 15467891..15468303 1..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:42 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
X 15467891..15468303 1..413 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:58 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15361924..15362336 1..413 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:03 Download gff for FI16901.complete
Subject Subject Range Query Range Percent Splice Strand
X 15475989..15476401 1..413 100   Plus

FI16901.pep Sequence

Translation from 0 to 383

> FI16901.pep
RDQRTMRRQGVHCCCLVAIALAMAIRQVSMGISASDRRFQCLQTRLIGQA
NCSPCADLYVFNRQSAYRRCEHVNGNCYPHRTVFASARMCELTCQPYIRR
PTLHEVTTLPPPPPIVEPFGDSDEEFE*

FI16901.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22259-PA 126 GF22259-PA 26..117 31..125 245 54.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17883-PA 121 GG17883-PA 1..121 6..127 453 75.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15641-PA 122 CG15641-PA 1..122 6..127 669 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19568-PA 122 GM19568-PA 1..122 6..127 563 91.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18851-PA 122 GK18851-PA 22..121 25..127 281 50.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17189-PA 121 GE17189-PA 1..121 6..127 427 70.5 Plus

FI16901.hyp Sequence

Translation from 0 to 383

> FI16901.hyp
RDQRTMRRQGVHCCCLVAIALAMAIRQVSMGISASDRRFQCLQTRLIGQA
NCSPCADLYVFNRQSAYRRCEHVNGNCYPHRTVFASARMCELTCQPYIRR
PTLHEVTTLPPPPPIVEPFGDSDEEFE*

FI16901.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15641-PA 122 CG15641-PA 1..122 6..127 669 100 Plus