BDGP Sequence Production Resources |
Search the DGRC for FI16905
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 169 |
Well: | 5 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG12826-RA |
Protein status: | FI16905.pep: gold |
Sequenced Size: | 735 |
735 bp assembled on 2011-11-23
GenBank Submission: BT132792.1
> FI16905.complete AGAAATCGAAGCAGCCAGCAAGAAATCAAAGGATAACCCACAGCAGCCCA ACCAGGATTTACCAAATCACAGCCAGTTTAAAGCGATCTAAGCCCAGCAC AATGGATCTTAAGCAATTGTACTCGTGGATCTGCCTGCTGATCAGCATCA TCATCTGCAAAGTGTCCGAGGCCAAGCCCACCTACTACGACTTGGATAGC TACGAAAACTACGACACAGATCGCTATGACAGCTACGGCGGGTCCTCGTA CGCCCTGACCTACGGGAAACCGTTAACGGACAACCGCCTTAAGAAGCTGA GTCCGGGCTACTACTACGTGGACGATGGGTACATCGCCCCGGTGGCCTCC AGCGCCGGCTACACCCGCCGCGAGGGCGTCTCCGCCTCCGACAGTGGCTC CTTGCCCCACAATGTCAAGTTTACTCCCATCGTGCGCGTCCGGCAGACCA AGACCAAGCGCAAGAAGCTCTTCGTGCCCAACTTCTTTGGCTAGAGGGGC TTCCCCTGCTCTCCTCCTGCCGGGACTGAGACTACAGACTGAGGATGATA GCATAGGCTTAGCATTAGCATTAGTCGCGTGGCTCCCACACCAAAAAGTA CCTTATACCTATACGTTATCTATTTTATACGCGGTCACATGTCTGACCAC ATTATATTTATATACGCAAAGCTACTAAATAAAAATATCCAAAATATTGA AAACATATATCAACTTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Porto1 | 4682 | Porto1 DOC5 4682bp | 949..998 | 666..715 | 115 | 70 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 3558298..3558410 | 1..113 | 100 | Minus | |
chr2R | 3557634..3558237 | 114..717 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12826-RA | 1..393 | 102..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12826-RA | 1..393 | 102..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12826-RA | 1..393 | 102..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12826-RA | 1..717 | 1..717 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12826-RA | 1..717 | 1..717 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12826-RA | 1..717 | 1..717 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7670327..7670930 | 114..717 | 100 | <- | Minus |
2R | 7670991..7671103 | 1..113 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7670327..7670930 | 114..717 | 100 | <- | Minus |
2R | 7670991..7671103 | 1..113 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7670327..7670930 | 114..717 | 100 | <- | Minus |
2R | 7670991..7671103 | 1..113 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 3557832..3558435 | 114..717 | 100 | <- | Minus |
arm_2R | 3558496..3558608 | 1..113 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7671526..7672129 | 114..717 | 100 | <- | Minus |
2R | 7672190..7672302 | 1..113 | 100 | Minus |
Translation from 2 to 493
> FI16905.hyp KSKQPARNQRITHSSPTRIYQITASLKRSKPSTMDLKQLYSWICLLISII ICKVSEAKPTYYDLDSYENYDTDRYDSYGGSSYALTYGKPLTDNRLKKLS PGYYYVDDGYIAPVASSAGYTRREGVSASDSGSLPHNVKFTPIVRVRQTK TKRKKLFVPNFFG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12826-PA | 130 | CG12826-PA | 1..130 | 34..163 | 690 | 100 | Plus |
Translation from 2 to 493
> FI16905.pep KSKQPARNQRITHSSPTRIYQITASLKRSKPSTMDLKQLYSWICLLISII ICKVSEAKPTYYDLDSYENYDTDRYDSYGGSSYALTYGKPLTDNRLKKLS PGYYYVDDGYIAPVASSAGYTRREGVSASDSGSLPHNVKFTPIVRVRQTK TKRKKLFVPNFFG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11702-PA | 126 | GF11702-PA | 1..126 | 34..163 | 535 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10723-PA | 130 | GG10723-PA | 1..130 | 34..163 | 625 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20016-PA | 135 | GH20016-PA | 1..135 | 34..163 | 367 | 56.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12826-PA | 130 | CG12826-PA | 1..130 | 34..163 | 690 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19195-PA | 132 | GI19195-PA | 1..132 | 34..163 | 331 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11540-PA | 130 | GL11540-PA | 1..130 | 34..163 | 500 | 73.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11837-PA | 135 | GA11837-PA | 1..135 | 34..163 | 489 | 71.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20770-PA | 130 | GM20770-PA | 1..130 | 34..163 | 684 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15303-PA | 130 | GD15303-PA | 1..130 | 34..163 | 684 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20262-PA | 133 | GJ20262-PA | 1..133 | 34..163 | 301 | 55.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19669-PA | 114 | GK19669-PA | 1..114 | 54..163 | 362 | 69.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23739-PA | 130 | GE23739-PA | 1..130 | 34..163 | 566 | 93.8 | Plus |