Clone FI16905 Report

Search the DGRC for FI16905

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:5
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG12826-RA
Protein status:FI16905.pep: gold
Sequenced Size:735

Clone Sequence Records

FI16905.complete Sequence

735 bp assembled on 2011-11-23

GenBank Submission: BT132792.1

> FI16905.complete
AGAAATCGAAGCAGCCAGCAAGAAATCAAAGGATAACCCACAGCAGCCCA
ACCAGGATTTACCAAATCACAGCCAGTTTAAAGCGATCTAAGCCCAGCAC
AATGGATCTTAAGCAATTGTACTCGTGGATCTGCCTGCTGATCAGCATCA
TCATCTGCAAAGTGTCCGAGGCCAAGCCCACCTACTACGACTTGGATAGC
TACGAAAACTACGACACAGATCGCTATGACAGCTACGGCGGGTCCTCGTA
CGCCCTGACCTACGGGAAACCGTTAACGGACAACCGCCTTAAGAAGCTGA
GTCCGGGCTACTACTACGTGGACGATGGGTACATCGCCCCGGTGGCCTCC
AGCGCCGGCTACACCCGCCGCGAGGGCGTCTCCGCCTCCGACAGTGGCTC
CTTGCCCCACAATGTCAAGTTTACTCCCATCGTGCGCGTCCGGCAGACCA
AGACCAAGCGCAAGAAGCTCTTCGTGCCCAACTTCTTTGGCTAGAGGGGC
TTCCCCTGCTCTCCTCCTGCCGGGACTGAGACTACAGACTGAGGATGATA
GCATAGGCTTAGCATTAGCATTAGTCGCGTGGCTCCCACACCAAAAAGTA
CCTTATACCTATACGTTATCTATTTTATACGCGGTCACATGTCTGACCAC
ATTATATTTATATACGCAAAGCTACTAAATAAAAATATCCAAAATATTGA
AAACATATATCAACTTTAAAAAAAAAAAAAAAAAA

FI16905.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3557634..3558239 717..112 3030 100 Minus
chr2R 21145070 chr2R 3558298..3558410 113..1 565 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7670322..7670932 722..112 3055 100 Minus
2R 25286936 2R 7670991..7671103 113..1 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7671521..7672131 722..112 3055 100 Minus
2R 25260384 2R 7672190..7672302 113..1 565 100 Minus
Blast to na_te.dros performed 2019-03-15 11:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Porto1 4682 Porto1 DOC5 4682bp 949..998 666..715 115 70 Plus

FI16905.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:31:34 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3558298..3558410 1..113 100   Minus
chr2R 3557634..3558237 114..717 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:52:18 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG12826-RA 1..393 102..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:56 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG12826-RA 1..393 102..494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:37:19 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG12826-RA 1..393 102..494 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:52:18 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG12826-RA 1..717 1..717 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:56 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG12826-RA 1..717 1..717 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:37:19 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG12826-RA 1..717 1..717 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:34 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7670327..7670930 114..717 100 <- Minus
2R 7670991..7671103 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:34 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7670327..7670930 114..717 100 <- Minus
2R 7670991..7671103 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:34 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7670327..7670930 114..717 100 <- Minus
2R 7670991..7671103 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:56 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3557832..3558435 114..717 100 <- Minus
arm_2R 3558496..3558608 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:49 Download gff for FI16905.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7671526..7672129 114..717 100 <- Minus
2R 7672190..7672302 1..113 100   Minus

FI16905.hyp Sequence

Translation from 2 to 493

> FI16905.hyp
KSKQPARNQRITHSSPTRIYQITASLKRSKPSTMDLKQLYSWICLLISII
ICKVSEAKPTYYDLDSYENYDTDRYDSYGGSSYALTYGKPLTDNRLKKLS
PGYYYVDDGYIAPVASSAGYTRREGVSASDSGSLPHNVKFTPIVRVRQTK
TKRKKLFVPNFFG*

FI16905.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12826-PA 130 CG12826-PA 1..130 34..163 690 100 Plus

FI16905.pep Sequence

Translation from 2 to 493

> FI16905.pep
KSKQPARNQRITHSSPTRIYQITASLKRSKPSTMDLKQLYSWICLLISII
ICKVSEAKPTYYDLDSYENYDTDRYDSYGGSSYALTYGKPLTDNRLKKLS
PGYYYVDDGYIAPVASSAGYTRREGVSASDSGSLPHNVKFTPIVRVRQTK
TKRKKLFVPNFFG*

FI16905.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11702-PA 126 GF11702-PA 1..126 34..163 535 82.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10723-PA 130 GG10723-PA 1..130 34..163 625 90.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20016-PA 135 GH20016-PA 1..135 34..163 367 56.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12826-PA 130 CG12826-PA 1..130 34..163 690 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19195-PA 132 GI19195-PA 1..132 34..163 331 53.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11540-PA 130 GL11540-PA 1..130 34..163 500 73.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11837-PA 135 GA11837-PA 1..135 34..163 489 71.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20770-PA 130 GM20770-PA 1..130 34..163 684 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15303-PA 130 GD15303-PA 1..130 34..163 684 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20262-PA 133 GJ20262-PA 1..133 34..163 301 55.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19669-PA 114 GK19669-PA 1..114 54..163 362 69.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23739-PA 130 GE23739-PA 1..130 34..163 566 93.8 Plus