Clone FI16906 Report

Search the DGRC for FI16906

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:6
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG13177-RA
Protein status:FI16906.pep: gold
Sequenced Size:665

Clone Sequence Records

FI16906.complete Sequence

665 bp assembled on 2011-11-23

GenBank Submission: BT132817.1

> FI16906.complete
AGTTTACGGACAACAACGCTTCTGGCCAGAACACGATCGGGAAAAGTTGC
TAATTTGAGAGAAAAACATAAAATCTAGAGTGCATCCCCGTTAAATTTCG
CAAATAAAAGCAACAATGGCAAAGTTATTTTCCATCCTTTTGTGCCTGGC
TATTATCGGATTCATCAGCGCAGCTCCTATAGAGGACAAGAAACCCGCTG
AGGAGGCTGATCTCTCCACCGCGGACTCCATTGGCTACGGCTACTATGCA
GCTCCATCGCCAATTTACTACGGCGGCTATGGAGGTGGCTACAAGTACGG
CGGATATTCCGGTTACGGCGGCTACGGCGGATATCGCTCCTACGGAGGCG
GATTCTATCGTCCCCGAATTTACCCAGTTTGGGGATAATACTATGATGCC
AGACCGAAAAACGTTCCTTAAGCAAGAAGTTTCAGACATATGGACATACG
TTCCTTAATCCACAAAATCCTATGTAATCGCACTAGTGACCAAAGAAGTT
ATACAAGCAAGCCCCCCAGTTTTGAAATTTTAACCCTTTCACTGTCTTGC
AACGACGAGTTGATGACGTCAGCGGCAGTTTTTGACCCCAGAGCACAATT
AACACCGGCTTTATTGCAATAAAAACAAAACAAAAACAAAAAAAAAAAAA
GAAAAAAAAAAAAAA

FI16906.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8051197..8051657 183..643 2305 100 Plus
chr2R 21145070 chr2R 8050892..8051020 1..129 630 99.2 Plus
chr2R 21145070 chr2R 8051075..8051137 123..185 315 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12163982..12164442 183..643 2305 100 Plus
2R 25286936 2R 12163677..12163805 1..129 630 99.2 Plus
2R 25286936 2R 12163860..12163922 123..185 315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12165181..12165641 183..643 2305 100 Plus
2R 25260384 2R 12164876..12165004 1..129 630 99.2 Plus
2R 25260384 2R 12165059..12165121 123..185 315 100 Plus
Blast to na_te.dros performed 2019-03-15 11:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dhet\Uhu 1658 Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). 431..524 95..190 115 59.4 Plus

FI16906.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:29:59 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8050892..8051015 1..124 100 -> Plus
chr2R 8051077..8051136 125..184 100 -> Plus
chr2R 8051199..8051631 185..617 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:15:38 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 1..273 116..388 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:00 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 1..273 116..388 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:50 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 1..273 116..388 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:15:37 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 3..596 1..594 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:00 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 3..619 1..617 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:50 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RB 3..619 1..617 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:59 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12163677..12163800 1..124 100 -> Plus
2R 12163862..12163921 125..184 100 -> Plus
2R 12163984..12164416 185..617 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:59 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12163677..12163800 1..124 100 -> Plus
2R 12163862..12163921 125..184 100 -> Plus
2R 12163984..12164416 185..617 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:59 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12163677..12163800 1..124 100 -> Plus
2R 12163862..12163921 125..184 100 -> Plus
2R 12163984..12164416 185..617 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:00 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8051182..8051305 1..124 100 -> Plus
arm_2R 8051367..8051426 125..184 100 -> Plus
arm_2R 8051489..8051921 185..617 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:21 Download gff for FI16906.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12165183..12165615 185..617 100   Plus
2R 12164876..12164999 1..124 100 -> Plus
2R 12165061..12165120 125..184 100 -> Plus

FI16906.pep Sequence

Translation from 115 to 387

> FI16906.pep
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWG*

FI16906.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12296-PA 88 GF12296-PA 1..88 1..90 165 60 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20250-PA 90 GG20250-PA 1..90 1..90 255 94.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-PB 90 CG13177-PB 1..90 1..90 497 100 Plus
CG13177-PA 90 CG13177-PA 1..90 1..90 497 100 Plus
CG9269-PA 146 CG9269-PA 31..96 23..87 133 47.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21337-PA 90 GM21337-PA 1..90 1..90 423 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15396-PA 90 GD15396-PA 1..90 1..90 427 97.8 Plus
Dsim\GD10843-PA 90 GD10843-PA 1..90 1..90 426 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12409-PA 90 GE12409-PA 1..90 1..90 261 94.4 Plus

FI16906.hyp Sequence

Translation from 115 to 387

> FI16906.hyp
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWG*

FI16906.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-PB 90 CG13177-PB 1..90 1..90 497 100 Plus
CG13177-PA 90 CG13177-PA 1..90 1..90 497 100 Plus
CG9269-PA 146 CG9269-PA 31..96 23..87 133 47.1 Plus