Clone Sequence Records
FI16906.complete Sequence
665 bp assembled on 2011-11-23
GenBank Submission: BT132817.1
> FI16906.complete
AGTTTACGGACAACAACGCTTCTGGCCAGAACACGATCGGGAAAAGTTGC
TAATTTGAGAGAAAAACATAAAATCTAGAGTGCATCCCCGTTAAATTTCG
CAAATAAAAGCAACAATGGCAAAGTTATTTTCCATCCTTTTGTGCCTGGC
TATTATCGGATTCATCAGCGCAGCTCCTATAGAGGACAAGAAACCCGCTG
AGGAGGCTGATCTCTCCACCGCGGACTCCATTGGCTACGGCTACTATGCA
GCTCCATCGCCAATTTACTACGGCGGCTATGGAGGTGGCTACAAGTACGG
CGGATATTCCGGTTACGGCGGCTACGGCGGATATCGCTCCTACGGAGGCG
GATTCTATCGTCCCCGAATTTACCCAGTTTGGGGATAATACTATGATGCC
AGACCGAAAAACGTTCCTTAAGCAAGAAGTTTCAGACATATGGACATACG
TTCCTTAATCCACAAAATCCTATGTAATCGCACTAGTGACCAAAGAAGTT
ATACAAGCAAGCCCCCCAGTTTTGAAATTTTAACCCTTTCACTGTCTTGC
AACGACGAGTTGATGACGTCAGCGGCAGTTTTTGACCCCAGAGCACAATT
AACACCGGCTTTATTGCAATAAAAACAAAACAAAAACAAAAAAAAAAAAA
GAAAAAAAAAAAAAA
FI16906.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 8051197..8051657 | 183..643 | 2305 | 100 | Plus |
chr2R | 21145070 | chr2R | 8050892..8051020 | 1..129 | 630 | 99.2 | Plus |
chr2R | 21145070 | chr2R | 8051075..8051137 | 123..185 | 315 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12163982..12164442 | 183..643 | 2305 | 100 | Plus |
2R | 25286936 | 2R | 12163677..12163805 | 1..129 | 630 | 99.2 | Plus |
2R | 25286936 | 2R | 12163860..12163922 | 123..185 | 315 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 12165181..12165641 | 183..643 | 2305 | 100 | Plus |
2R | 25260384 | 2R | 12164876..12165004 | 1..129 | 630 | 99.2 | Plus |
2R | 25260384 | 2R | 12165059..12165121 | 123..185 | 315 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 11:28:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dhet\Uhu | 1658 | Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). | 431..524 | 95..190 | 115 | 59.4 | Plus |
FI16906.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:29:59 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 8050892..8051015 | 1..124 | 100 | -> | Plus |
chr2R | 8051077..8051136 | 125..184 | 100 | -> | Plus |
chr2R | 8051199..8051631 | 185..617 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:15:38 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 1..273 | 116..388 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:00 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 1..273 | 116..388 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:50 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 1..273 | 116..388 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:15:37 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 3..596 | 1..594 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:00 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 3..619 | 1..617 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:50 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RB | 3..619 | 1..617 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:59 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12163677..12163800 | 1..124 | 100 | -> | Plus |
2R | 12163862..12163921 | 125..184 | 100 | -> | Plus |
2R | 12163984..12164416 | 185..617 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:59 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12163677..12163800 | 1..124 | 100 | -> | Plus |
2R | 12163862..12163921 | 125..184 | 100 | -> | Plus |
2R | 12163984..12164416 | 185..617 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:59 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12163677..12163800 | 1..124 | 100 | -> | Plus |
2R | 12163862..12163921 | 125..184 | 100 | -> | Plus |
2R | 12163984..12164416 | 185..617 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:00 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8051182..8051305 | 1..124 | 100 | -> | Plus |
arm_2R | 8051367..8051426 | 125..184 | 100 | -> | Plus |
arm_2R | 8051489..8051921 | 185..617 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:21 Download gff for
FI16906.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12165183..12165615 | 185..617 | 100 | | Plus |
2R | 12164876..12164999 | 1..124 | 100 | -> | Plus |
2R | 12165061..12165120 | 125..184 | 100 | -> | Plus |
FI16906.pep Sequence
Translation from 115 to 387
> FI16906.pep
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWG*
FI16906.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:50:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12296-PA | 88 | GF12296-PA | 1..88 | 1..90 | 165 | 60 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:50:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20250-PA | 90 | GG20250-PA | 1..90 | 1..90 | 255 | 94.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13177-PB | 90 | CG13177-PB | 1..90 | 1..90 | 497 | 100 | Plus |
CG13177-PA | 90 | CG13177-PA | 1..90 | 1..90 | 497 | 100 | Plus |
CG9269-PA | 146 | CG9269-PA | 31..96 | 23..87 | 133 | 47.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:50:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21337-PA | 90 | GM21337-PA | 1..90 | 1..90 | 423 | 98.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:50:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15396-PA | 90 | GD15396-PA | 1..90 | 1..90 | 427 | 97.8 | Plus |
Dsim\GD10843-PA | 90 | GD10843-PA | 1..90 | 1..90 | 426 | 97.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:50:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12409-PA | 90 | GE12409-PA | 1..90 | 1..90 | 261 | 94.4 | Plus |
FI16906.hyp Sequence
Translation from 115 to 387
> FI16906.hyp
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWG*
FI16906.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13177-PB | 90 | CG13177-PB | 1..90 | 1..90 | 497 | 100 | Plus |
CG13177-PA | 90 | CG13177-PA | 1..90 | 1..90 | 497 | 100 | Plus |
CG9269-PA | 146 | CG9269-PA | 31..96 | 23..87 | 133 | 47.1 | Plus |