Clone FI16908 Report

Search the DGRC for FI16908

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:8
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34194-RA
Protein status:FI16908.pep: gold
Sequenced Size:690

Clone Sequence Records

FI16908.complete Sequence

690 bp assembled on 2011-11-23

GenBank Submission: BT132821.1

> FI16908.complete
AGTTTACAAGTGCAAGCGTAGCCGCATGGACTGATTTTTATCGCAACGCC
CAACTGACGGCCGAAAGAGGCCCGAAATGAAATCTATTTAATTTGGTTTA
CAGCCCGAAAAATGTATAAAAACATATATATATATACATAAATATATGTG
TGGTTAGAGAATAAAAACGCGTGTAGTTGTATGCAGTGATAAGGCGGTGA
CGGGGACACAGGTACCAGGTGTCGAAGTTGGCACTAGGCTAGTCCGCCGC
GCACCCTGACACCGTCCACATCGCCTGACGTCGATTGCAGAAGCCCATGT
CGCAAAGCATGTTCCCAAAGCTGGCCGAGGATTACGCGAAATTCAAGCGC
TATGTGAAATGGCTGTACACCCTCTACGAACTGAACACACAGATCGCCAT
ATGTGAGCCGTGGGAAAAGGTCTTCCTCAATGTCCTCCTCGGCAGCTTCG
TCTCCCTGATCCTCTACGCATCCTTTGCCTTTGTGCCGGGCTATTGTGTC
ACCGTCTTCCAGCTTTTATGGCCCCAAACGAGCGTGCAAAATCTCACCAG
CGTTTGCAGTACGAGTACGGAGGGCTTTTGCGGCAACGAAAGCGGATCAG
TAATAACATAATCTTAGTGTAGCTTATCTTAATCAATAAATAATTTAATA
CCTAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI16908.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13431244..13431672 1..429 2145 100 Plus
chr2R 21145070 chr2R 13431874..13432098 430..654 1110 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17544192..17544620 1..429 2145 100 Plus
2R 25286936 2R 17544822..17545046 430..654 1125 100 Plus
2R 25286936 2R 518277..518334 633..690 185 87.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17545391..17545819 1..429 2145 100 Plus
2R 25260384 2R 17546021..17546245 430..654 1125 100 Plus
2R 25260384 2R 518277..518334 633..690 185 87.9 Plus
Blast to na_te.dros performed 2019-03-15 11:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1049..1104 601..657 111 68.4 Plus

FI16908.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:27:50 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13431874..13432100 430..658 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:35 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 1..315 297..611 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:09 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 1..315 297..611 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:34:25 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 1..315 297..611 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:35 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 1..520 137..658 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:09 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RB 3..655 1..653 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:34:25 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RB 3..655 1..653 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:50 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17544192..17544620 1..429 100 -> Plus
2R 17544822..17545048 430..658 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:50 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17544192..17544620 1..429 100 -> Plus
2R 17544822..17545048 430..658 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:50 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17544192..17544620 1..429 100 -> Plus
2R 17544822..17545048 430..658 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:09 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13431697..13432125 1..429 100 -> Plus
arm_2R 13432327..13432553 430..658 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:06 Download gff for FI16908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17545391..17545819 1..429 100 -> Plus
2R 17546021..17546247 430..658 98   Plus

FI16908.hyp Sequence

Translation from 296 to 610

> FI16908.hyp
MSQSMFPKLAEDYAKFKRYVKWLYTLYELNTQIAICEPWEKVFLNVLLGS
FVSLILYASFAFVPGYCVTVFQLLWPQTSVQNLTSVCSTSTEGFCGNESG
SVIT*

FI16908.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-PB 104 CG34194-PB 1..104 1..104 550 100 Plus
CG34194-PA 104 CG34194-PA 1..104 1..104 550 100 Plus

FI16908.pep Sequence

Translation from 296 to 610

> FI16908.pep
MSQSMFPKLAEDYAKFKRYVKWLYTLYELNTQIAICEPWEKVFLNVLLGS
FVSLILYASFAFVPGYCVTVFQLLWPQTSVQNLTSVCSTSTEGFCGNESG
SVIT*

FI16908.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11346-PA 394 GF11346-PA 1..96 5..101 420 77.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21794-PA 100 GG21794-PA 1..100 5..104 497 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20759-PA 103 GH20759-PA 1..103 5..104 296 56.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-PB 104 CG34194-PB 1..104 1..104 550 100 Plus
CG34194-PA 104 CG34194-PA 1..104 1..104 550 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11463-PA 100 GL11463-PA 1..100 5..104 365 68 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24737-PA 100 GA24737-PA 1..100 5..104 364 68 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21796-PA 100 GM21796-PA 1..100 5..104 505 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11287-PA 104 GD11287-PA 1..104 1..104 533 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20578-PA 101 GJ20578-PA 1..72 5..76 273 68.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11870-PA 100 GE11870-PA 1..100 5..104 499 94 Plus