Clone FI16912 Report

Search the DGRC for FI16912

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG6149-RB
Protein status:FI16912.pep: gold
Sequenced Size:807

Clone Sequence Records

FI16912.complete Sequence

807 bp assembled on 2011-11-23

GenBank Submission: BT132798.1

> FI16912.complete
AGTATCTATCCGGAAATGGAGCGACTTAATTTGTCGAACAGGGCTCGCCT
GTTTTTCCACCTGTCGGCCACCGTTCACCTGGGCTATGCCATTTACTTTG
ACTGTCGGTATGCCCAGTTGCCACAAGTGGCGGTGACCCTGCGCCTGGAG
CCACCGATTGGTGGCAAGTTTAAGTACATGACGTTTCTGTGCGGCCTTTT
GCAGTTGGGGTACTATACACTGGCGCTGACCTTTGACCTCCTCCGATTGA
GATCTCTAAGGAAGCTGCGAGACTACATCTTCGCCACCTTTGCCGTACCT
CTGGCCCTTACGGTGGGTCTCACCTTTTGGACACTCTTCGCCATCGATCG
GGAAGTGATATATCCGGTGCTTTTGGACCTGGTCTATCCCAATTGGCTGA
ACCACACCATGCACACCTTCGTCGTAATCTATGCCTTTGTGGAGTTGGGT
ATTACACGACATCAATATCCGAAACGCAGTCGAGGATTCACTGGACTGGG
TGCCTTCATGTTGGGATATCTGGTGTGGATACATATCGTTTGGTTCCGGA
CCGACATCTGGGTGTATCCCTTTCTGGGCGGCATCGCCTGGCAGCTGAGA
GTAATTTTCTTTGTCCTTATCATGGTCCTCGGATTCATTTACTATCTCTT
CGGCGAGCGAGTTAATAACGTCTTGTGGCAGCGATCTACTGGTGTCCACA
GATGGATCGATTCCCATTGAAATGCACATTTGATAGTTTAAGGATAGGAA
CATAAATAAAGTATATAGGATATGCTTCTTATAAAAAAAAAAAAAAAAAA
AAAAAAA

FI16912.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11425452..11426239 782..1 3650 97.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11434691..11435476 786..1 3915 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11427791..11428576 786..1 3915 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 11:31:09 has no hits.

FI16912.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:31:49 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11425452..11426239 1..782 97   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:58:25 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
CG6149-RB 1..705 16..720 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:46:07 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
CG6149-RB 1..705 16..720 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:37:42 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
CG6149-RB 1..705 16..720 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:58:25 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
CG6149-RB 1..705 16..720 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:46:07 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
CG6149-RB 1..782 1..782 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:37:42 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
CG6149-RB 1..782 1..782 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:49 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11434695..11435476 1..782 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:49 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11434695..11435476 1..782 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:49 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11434695..11435476 1..782 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:46:07 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11427795..11428576 1..782 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:51 Download gff for FI16912.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11427795..11428576 1..782 100   Minus

FI16912.hyp Sequence

Translation from 0 to 719

> FI16912.hyp
SIYPEMERLNLSNRARLFFHLSATVHLGYAIYFDCRYAQLPQVAVTLRLE
PPIGGKFKYMTFLCGLLQLGYYTLALTFDLLRLRSLRKLRDYIFATFAVP
LALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELG
ITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLR
VIFFVLIMVLGFIYYLFGERVNNVLWQRSTGVHRWIDSH*

FI16912.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG6149-PB 234 CG6149-PB 1..234 6..239 1254 100 Plus
CG3625-PB 248 CG3625-PB 18..238 16..228 527 43.4 Plus
CG3625-PA 245 CG3625-PA 23..235 16..228 471 39.4 Plus
CG3625-PE 247 CG3625-PE 8..237 14..228 422 37 Plus
CG3625-PC 247 CG3625-PC 8..237 14..228 422 37 Plus

FI16912.pep Sequence

Translation from 0 to 719

> FI16912.pep
SIYPEMERLNLSNRARLFFHLSATVHLGYAIYFDCRYAQLPQVAVTLRLE
PPIGGKFKYMTFLCGLLQLGYYTLALTFDLLRLRSLRKLRDYIFATFAVP
LALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELG
ITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLR
VIFFVLIMVLGFIYYLFGERVNNVLWQRSTGVHRWIDSH*

FI16912.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24553-PA 310 GF24553-PA 1..233 6..235 854 67 Plus
Dana\GF24926-PA 250 GF24926-PA 20..246 16..234 501 41.4 Plus
Dana\GF24937-PA 275 GF24937-PA 41..261 16..227 395 40.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13922-PA 236 GG13922-PA 1..229 6..234 1055 89.1 Plus
Dere\GG24663-PA 248 GG24663-PA 18..244 16..234 500 41.9 Plus
Dere\GG24665-PA 275 GG24665-PA 41..260 16..226 389 40.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10220-PA 252 GH10220-PA 20..248 16..234 498 41.9 Plus
Dgri\GH11507-PA 277 GH11507-PA 41..262 16..226 362 39.6 Plus
Dgri\GH23361-PA 129 GH23361-PA 9..129 16..139 350 55.6 Plus
Dgri\GH14847-PA 129 GH14847-PA 9..129 16..139 343 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6149-PB 234 CG6149-PB 1..234 6..239 1254 100 Plus
CG3625-PB 248 CG3625-PB 18..238 16..228 527 43.4 Plus
CG3625-PA 245 CG3625-PA 23..235 16..228 471 39.4 Plus
CG3625-PE 247 CG3625-PE 8..237 14..228 422 37 Plus
CG3625-PC 247 CG3625-PC 8..237 14..228 422 37 Plus
CG11601-PC 275 CG11601-PC 41..260 16..226 422 40.5 Plus
CG11601-PB 275 CG11601-PB 41..260 16..226 422 40.5 Plus
CG11601-PA 275 CG11601-PA 41..260 16..226 422 40.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15038-PA 252 GI15038-PA 20..243 16..229 492 42.4 Plus
Dmoj\GI13700-PA 223 GI13700-PA 2..218 13..229 473 50.7 Plus
Dmoj\GI17003-PA 275 GI17003-PA 23..260 7..226 404 39.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25826-PA 249 GL25826-PA 19..245 16..234 511 43.2 Plus
Dper\GL25827-PA 114 GL25827-PA 3..99 131..227 170 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19393-PA 239 GA19393-PA 1..239 6..239 785 61.9 Plus
Dpse\GA17568-PA 249 GA17568-PA 19..245 16..234 509 42.7 Plus
Dpse\GA11092-PA 277 GA11092-PA 22..259 6..226 388 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24755-PA 296 GM24755-PA 56..296 1..239 1124 95 Plus
Dsec\GM16682-PA 245 GM16682-PA 19..241 13..234 445 37.7 Plus
Dsec\GM16683-PA 275 GM16683-PA 17..260 1..226 395 38.1 Plus
Dsec\GM13272-PA 141 GM13272-PA 18..140 16..130 279 43.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12806-PA 296 GD12806-PA 56..296 1..239 1184 95 Plus
Dsim\GD22970-PA 245 GD22970-PA 19..241 13..234 445 37.7 Plus
Dsim\GD22971-PA 275 GD22971-PA 17..260 1..226 394 38.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14040-PA 228 GJ14040-PA 1..227 6..229 669 58.1 Plus
Dvir\GJ17242-PA 251 GJ17242-PA 19..247 16..234 494 41 Plus
Dvir\GJ24281-PA 275 GJ24281-PA 41..260 16..226 381 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14825-PA 257 GK14825-PA 25..253 16..234 486 41.3 Plus
Dwil\GK14826-PA 275 GK14826-PA 41..260 16..226 356 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20218-PA 229 GE20218-PA 1..229 6..234 981 88.6 Plus
Dyak\GE16272-PA 248 GE16272-PA 18..244 16..234 505 42.3 Plus
Dyak\GE16283-PA 275 GE16283-PA 41..260 16..226 383 39.5 Plus