Clone FI16913 Report

Search the DGRC for FI16913

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:13
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG1701-RB
Protein status:FI16913.pep: gold
Sequenced Size:477

Clone Sequence Records

FI16913.complete Sequence

477 bp assembled on 2011-11-23

GenBank Submission: BT132805.1

> FI16913.complete
CCGAGTATTATCGCCACATTCAGAAATGCGACTTTTTCCAGTTTACTTTG
CTATAATCTTCCTGTTTCAATATGATGTCTACTCCATATCGGATAATTTG
AAAACCGAACTGCGATCCTGGTTTGGAAATATAAAGCAACTGCACAATCC
GGCAACGCTCAACACTCTGAAAATGCTGTGCGTTGTGGAAGTGATGCGGG
GCAGCAAACATCGGATAAATGTTGGCAATATTGACATTTTGAATAAGAAT
ACTTTGGAAAACTTCATCAAGCTGCCGAGCTTTAAAATGCCGAACATCAC
AATTGTCATCGTGGAAGACGAGTTGTCCAAGATTGCGAGAAGCGGGAGTC
AGTATAAGGAACGGGAAATGGAAAAGCTAGTTCAACATTTTAAGGAATGT
ATACTTGCAAAACTTAAGGCACTATCTTAGTTACAAGCTAAAATTCTCTT
TTGAAAAAAAAAAAAAAAAAAAAAAAA

FI16913.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3296258..3296661 453..50 2020 100 Minus
chr2R 21145070 chr2R 3296724..3296773 50..1 250 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7408863..7409273 460..50 2040 99.8 Minus
2R 25286936 2R 7409336..7409385 50..1 250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7410062..7410472 460..50 2040 99.7 Minus
2R 25260384 2R 7410535..7410584 50..1 250 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:26:59 has no hits.

FI16913.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:27:57 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3296258..3296660 51..453 100 <- Minus
chr2R 3296724..3296773 1..50 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:36 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1701-RB 1..405 26..430 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:15 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1701-RC 1..405 26..430 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:34:41 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1701-RC 1..405 26..430 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:36 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1701-RB 1..405 26..430 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:15 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1701-RC 1..453 1..453 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:34:41 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1701-RC 1..453 1..453 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:57 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7408870..7409272 51..453 100 <- Minus
2R 7409336..7409385 1..50 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:57 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7408870..7409272 51..453 100 <- Minus
2R 7409336..7409385 1..50 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:57 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7408870..7409272 51..453 100 <- Minus
2R 7409336..7409385 1..50 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:15 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3296375..3296777 51..453 100 <- Minus
arm_2R 3296841..3296890 1..50 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:07 Download gff for FI16913.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7410069..7410471 51..453 100 <- Minus
2R 7410535..7410584 1..50 100   Minus

FI16913.hyp Sequence

Translation from 0 to 429

> FI16913.hyp
RVLSPHSEMRLFPVYFAIIFLFQYDVYSISDNLKTELRSWFGNIKQLHNP
ATLNTLKMLCVVEVMRGSKHRINVGNIDILNKNTLENFIKLPSFKMPNIT
IVIVEDELSKIARSGSQYKEREMEKLVQHFKECILAKLKALS*

FI16913.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG1701-PB 134 CG1701-PB 1..134 9..142 683 100 Plus
CG1701-PC 134 CG1701-PC 1..134 9..142 683 100 Plus
CG11113-PB 138 CG11113-PB 1..133 9..141 256 38.8 Plus

FI16913.pep Sequence

Translation from 1 to 429

> FI16913.pep
RVLSPHSEMRLFPVYFAIIFLFQYDVYSISDNLKTELRSWFGNIKQLHNP
ATLNTLKMLCVVEVMRGSKHRINVGNIDILNKNTLENFIKLPSFKMPNIT
IVIVEDELSKIARSGSQYKEREMEKLVQHFKECILAKLKALS*

FI16913.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10753-PA 132 GG10753-PA 5..132 15..142 480 71.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG1701-PB 134 CG1701-PB 1..134 9..142 683 100 Plus
CG1701-PC 134 CG1701-PC 1..134 9..142 683 100 Plus
CG11113-PB 138 CG11113-PB 1..133 9..141 256 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20799-PA 134 GM20799-PA 1..134 9..142 640 91.8 Plus
Dsec\GM20949-PA 155 GM20949-PA 14..151 3..142 252 37.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10261-PA 157 GD10261-PA 16..157 1..142 614 85.2 Plus
Dsim\GD10473-PA 155 GD10473-PA 25..151 16..142 240 38.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24058-PA 153 GE24058-PA 17..153 8..142 499 69.3 Plus