Clone FI16916 Report

Search the DGRC for FI16916

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:16
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34258-RA
Protein status:FI16916.pep: gold
Sequenced Size:647

Clone Sequence Records

FI16916.complete Sequence

647 bp assembled on 2011-11-23

GenBank Submission: BT132820.1

> FI16916.complete
TATATAAATTATGAAATGAAATTTTTTGTATTGCTAGTTTACATTTGCTT
GGCTCTCAAGTGCGGGCACCCGATAAACCTAAAAAATTACTATACTTCCA
CAACGCCTTTCTCTTCAGCCGATCATGAAATTTCATTTCCGGCTTGCGCA
AATTGTTCAAGTGAAAAGAACTTTCGTACCAACACTGATTTTCATTGCCA
CTTCGAAGATGACTCGGCCATTGAGGAAAATTTTGGAAAATGGACAAATA
GTTATCCGGACTGCCTGCCAGACCACTTTATTGCAACTCGGAAAATAAAA
GCGTATTGCTGCTTTTGGTCACCGAAATTGGGATGCTCTGCGCTGATCGG
AAGGAAGTTCTACGATAAGAAAATATATAGCTGCAAGACTTGCAGACGAT
TTTGCAGCGCAACTAAGCAAACCTATGTCGATGATTCGGATGGAAGTGAT
AAGGTCTCGGAATCCTACGGATTCTCAGTTTTATTGGCCTTTCTGCTACT
CAGCATATACTAGGATAATCTATAATTGCACAGTAGAATGGGATGGCCAT
TTTTATATAATTTATATTTTTGGACCCATCAAATTAACCATAACAAACAG
CAAATAAAAGGGTATCTTTTTAATTCACAAAAAAAAAAAAAAAAAAA

FI16916.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19940537..19940873 626..290 1640 99.1 Minus
chr3L 24539361 chr3L 19940927..19941100 290..117 870 100 Minus
chr3L 24539361 chr3L 19941156..19941273 118..1 590 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19951235..19951571 626..290 1685 100 Minus
3L 28110227 3L 19951625..19951798 290..117 870 100 Minus
3L 28110227 3L 19951854..19951971 118..1 590 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19944335..19944671 626..290 1685 100 Minus
3L 28103327 3L 19944725..19944898 290..117 870 100 Minus
3L 28103327 3L 19944954..19945071 118..1 590 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:27:11 has no hits.

FI16916.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:28:03 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19940534..19940873 290..628 91 <- Minus
chr3L 19940928..19941098 119..289 100 <- Minus
chr3L 19941156..19941273 1..118 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:38 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG34258-RA 1..498 16..513 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:22 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG34258-RA 1..498 16..513 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:34:52 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG34258-RA 1..498 16..513 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:38 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG34258-RA 1..510 4..513 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:22 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG34258-RA 1..623 4..626 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:34:52 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG34258-RA 1..623 4..626 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:03 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19951232..19951571 290..628 99 <- Minus
3L 19951626..19951796 119..289 100 <- Minus
3L 19951854..19951971 1..118 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:03 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19951232..19951571 290..628 99 <- Minus
3L 19951626..19951796 119..289 100 <- Minus
3L 19951854..19951971 1..118 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:03 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19951232..19951571 290..628 99 <- Minus
3L 19951626..19951796 119..289 100 <- Minus
3L 19951854..19951971 1..118 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:22 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19944332..19944671 290..628 99 <- Minus
arm_3L 19944726..19944896 119..289 100 <- Minus
arm_3L 19944954..19945071 1..118 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:11 Download gff for FI16916.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19944332..19944671 290..628 99 <- Minus
3L 19944726..19944896 119..289 100 <- Minus
3L 19944954..19945071 1..118 100   Minus

FI16916.pep Sequence

Translation from 0 to 512

> FI16916.pep
YINYEMKFFVLLVYICLALKCGHPINLKNYYTSTTPFSSADHEISFPACA
NCSSEKNFRTNTDFHCHFEDDSAIEENFGKWTNSYPDCLPDHFIATRKIK
AYCCFWSPKLGCSALIGRKFYDKKIYSCKTCRRFCSATKQTYVDDSDGSD
KVSESYGFSVLLAFLLLSIY*

FI16916.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13357-PA 164 GG13357-PA 1..164 6..170 302 37.6 Plus
Dere\GG13359-PA 151 GG13359-PA 33..144 49..169 156 32.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34258-PA 165 CG34258-PA 1..165 6..170 915 100 Plus
CG33710-PA 162 CG33710-PA 1..162 6..169 337 40.4 Plus
CG32219-PA 150 CG32219-PA 48..143 64..169 177 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15191-PA 163 GM15191-PA 1..163 6..170 329 41.3 Plus
Dsec\GM15297-PA 150 GM15297-PA 48..121 64..138 149 37.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17217-PA 147 GD17217-PA 33..121 48..138 151 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22760-PA 164 GE22760-PA 1..164 6..170 352 43.6 Plus
Dyak\GE22451-PA 164 GE22451-PA 1..164 6..170 352 43.6 Plus
Dyak\GE22452-PA 149 GE22452-PA 25..144 39..169 156 32.1 Plus
Dyak\GE22761-PA 149 GE22761-PA 25..144 39..169 155 32.1 Plus

FI16916.hyp Sequence

Translation from 0 to 512

> FI16916.hyp
YINYEMKFFVLLVYICLALKCGHPINLKNYYTSTTPFSSADHEISFPACA
NCSSEKNFRTNTDFHCHFEDDSAIEENFGKWTNSYPDCLPDHFIATRKIK
AYCCFWSPKLGCSALIGRKFYDKKIYSCKTCRRFCSATKQTYVDDSDGSD
KVSESYGFSVLLAFLLLSIY*

FI16916.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34258-PA 165 CG34258-PA 1..165 6..170 915 100 Plus
CG33710-PA 162 CG33710-PA 1..162 6..169 337 40.4 Plus
CG32219-PA 150 CG32219-PA 48..143 64..169 177 34.9 Plus