Clone FI16917 Report

Search the DGRC for FI16917

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:17
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42591-RA
Protein status:FI16917.pep: gold
Sequenced Size:532

Clone Sequence Records

FI16917.complete Sequence

532 bp assembled on 2011-11-23

GenBank Submission: BT132795.1

> FI16917.complete
ACTTTACTTAATAATTGCAAGCATGGACATTCAGAAGAAAAATATGAAGT
CACCTTCGAAGGATTCATCTGATTCCCCTGATGAAAAGCGCAAGTCCTTA
GAAATCGTGCCCCTATTAAAACCAGTTACCTTCAGTATTTCATACAGCTT
TGGATTGAATTGGTATTTGATCAACATGGAAGACTACATTCCTCGGAGAA
AGAGGAGGTACTTCATCAACCTATCGCTCTTCACCGATCAACTGCATACT
TTCATCCAGAGCACTCTGCTCCTCCTAAAGCGCCCAAAATGGAGCACCAT
CTTTCTGGCCACAACACCTCATAGCTTCACGTACTATCAAGCCCACTTCC
CGATGAAACCCATCCTGACATTCTCACCCATGATCAAGTCGACTTCGAAA
CTGGAATCTTGGAAGATTAAGGTAAAAGCCGGACATCCGCCCATGATAAA
CAATTCTAGGCCATCAAGGTCAAGTTCAGTAGCAAGTCGGTCTCGCAAAT
AAATTAACAAAAAAAAAAAAAAAAAAAAAAAA

FI16917.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8061516..8062020 505..1 2435 98.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8069449..8069960 512..1 2545 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8062549..8063060 512..1 2545 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 11:27:19 has no hits.

FI16917.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:28:07 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8061513..8062020 1..508 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:39 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
CG42591-RA 1..480 23..502 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:28 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
CG42591-RA 1..480 23..502 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:00 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
CG42591-RA 1..480 23..502 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:39 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
CG42591-RA 1..480 23..502 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:28 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
CG42591-RA 1..508 1..508 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:00 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
CG42591-RA 1..508 1..508 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:07 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8069453..8069960 1..508 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:07 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8069453..8069960 1..508 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:07 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8069453..8069960 1..508 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:28 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8062553..8063060 1..508 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:12 Download gff for FI16917.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8062553..8063060 1..508 99   Minus

FI16917.hyp Sequence

Translation from 0 to 501

> FI16917.hyp
LYLIIASMDIQKKNMKSPSKDSSDSPDEKRKSLEIVPLLKPVTFSISYSF
GLNWYLINMEDYIPRRKRRYFINLSLFTDQLHTFIQSTLLLLKRPKWSTI
FLATTPHSFTYYQAHFPMKPILTFSPMIKSTSKLESWKIKVKAGHPPMIN
NSRPSRSSSVASRSRK*

FI16917.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42591-PA 159 CG42591-PA 1..159 8..166 827 100 Plus

FI16917.pep Sequence

Translation from 1 to 501

> FI16917.pep
LYLIIASMDIQKKNMKSPSKDSSDSPDEKRKSLEIVPLLKPVTFSISYSF
GLNWYLINMEDYIPRRKRRYFINLSLFTDQLHTFIQSTLLLLKRPKWSTI
FLATTPHSFTYYQAHFPMKPILTFSPMIKSTSKLESWKIKVKAGHPPMIN
NSRPSRSSSVASRSRK*

FI16917.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14924-PA 153 GG14924-PA 1..143 8..150 350 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42591-PA 159 CG42591-PA 1..159 8..166 827 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24975-PA 155 GM24975-PA 1..155 8..166 512 73 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13024-PA 149 GD13024-PA 1..149 8..166 480 68.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20377-PA 160 GE20377-PA 1..139 8..146 429 61.9 Plus