BDGP Sequence Production Resources |
Search the DGRC for FI16919
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 169 |
Well: | 19 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG42489-RA |
Protein status: | FI16919.pep: gold |
Sequenced Size: | 388 |
388 bp assembled on 2011-11-23
GenBank Submission: BT132788.1
> FI16919.complete CCCAGTTGTATTCGCGGATCTCAGCTGTGTCAATTTCAGACTGTCAACAT ATAAACACGACGAGGATGCAGAAGCCACATCATGGTCCGTGCTGGATGTT GCTTCTACTGGCATCGCTGATCGGTACTTTTATGCTGGCCTTCAGCTACT GGATGTTTGTGCCGCGCGAGGAGTCACTATGGTCAATGATATCGAACTAC AGTGGATCTGGAATAAAGTACTCCCTGCCGCCGTCAGCAGTACCTGAGGA ACTTAAGCTTCGGCAGAGACCGCCCTTCGTTTACCAGATATTACATTGAA AGTAGAAGTACAATATAGTGTTTATATGCTATGTAATCTTACGCTAGTTT AACAATAAATTACATGTACACAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 4479791..4480163 | 373..1 | 1865 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 8653800..8654174 | 375..1 | 1875 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 8394631..8395005 | 375..1 | 1875 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4479791..4480163 | 1..373 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42489-RB | 1..234 | 66..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42489-RA | 1..234 | 66..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42489-RA | 1..234 | 66..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42489-RB | 176..437 | 38..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42489-RC | 1..373 | 1..373 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42489-RC | 1..373 | 1..373 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8653802..8654174 | 1..373 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8653802..8654174 | 1..373 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8653802..8654174 | 1..373 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4479524..4479896 | 1..373 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8394633..8395005 | 1..373 | 100 | Minus |
Translation from 2 to 298
> FI16919.hyp QLYSRISAVSISDCQHINTTRMQKPHHGPCWMLLLLASLIGTFMLAFSYW MFVPREESLWSMISNYSGSGIKYSLPPSAVPEELKLRQRPPFVYQILH*
Translation from 2 to 298
> FI16919.pep QLYSRISAVSISDCQHINTTRMQKPHHGPCWMLLLLASLIGTFMLAFSYW MFVPREESLWSMISNYSGSGIKYSLPPSAVPEELKLRQRPPFVYQILH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16330-PA | 78 | GF16330-PA | 1..78 | 22..98 | 283 | 70.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22887-PA | 86 | GH22887-PA | 1..85 | 22..97 | 167 | 38.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42489-PB | 77 | CG42489-PB | 1..77 | 22..98 | 419 | 100 | Plus |
CG42489-PC | 77 | CG42489-PC | 1..77 | 22..98 | 419 | 100 | Plus |
CG42489-PA | 77 | CG42489-PA | 1..77 | 22..98 | 419 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10231-PA | 84 | GI10231-PA | 1..83 | 22..97 | 162 | 42.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24501-PA | 78 | GL24501-PA | 1..78 | 22..98 | 246 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27303-PA | 78 | GA27303-PA | 1..78 | 22..98 | 253 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26330-PA | 79 | GM26330-PA | 1..79 | 22..98 | 358 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20855-PA | 79 | GD20855-PA | 1..79 | 22..98 | 365 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11035-PA | 84 | GJ11035-PA | 1..84 | 22..98 | 175 | 41.7 | Plus |