Clone FI16919 Report

Search the DGRC for FI16919

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:169
Well:19
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42489-RA
Protein status:FI16919.pep: gold
Sequenced Size:388

Clone Sequence Records

FI16919.complete Sequence

388 bp assembled on 2011-11-23

GenBank Submission: BT132788.1

> FI16919.complete
CCCAGTTGTATTCGCGGATCTCAGCTGTGTCAATTTCAGACTGTCAACAT
ATAAACACGACGAGGATGCAGAAGCCACATCATGGTCCGTGCTGGATGTT
GCTTCTACTGGCATCGCTGATCGGTACTTTTATGCTGGCCTTCAGCTACT
GGATGTTTGTGCCGCGCGAGGAGTCACTATGGTCAATGATATCGAACTAC
AGTGGATCTGGAATAAAGTACTCCCTGCCGCCGTCAGCAGTACCTGAGGA
ACTTAAGCTTCGGCAGAGACCGCCCTTCGTTTACCAGATATTACATTGAA
AGTAGAAGTACAATATAGTGTTTATATGCTATGTAATCTTACGCTAGTTT
AACAATAAATTACATGTACACAGAAAAAAAAAAAAAAA

FI16919.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4479791..4480163 373..1 1865 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8653800..8654174 375..1 1875 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8394631..8395005 375..1 1875 100 Minus
Blast to na_te.dros performed 2019-03-15 11:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy2 6841 gypsy2 GYPSY2 6841bp 875..940 354..290 111 65.2 Minus
412 7567 412 412 7567bp 6494..6549 369..313 111 68.4 Minus

FI16919.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:28:11 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4479791..4480163 1..373 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:40 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RB 1..234 66..299 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:30 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RA 1..234 66..299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:06 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RA 1..234 66..299 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:40 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RB 176..437 38..299 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:30 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RC 1..373 1..373 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:06 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RC 1..373 1..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:11 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653802..8654174 1..373 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:11 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653802..8654174 1..373 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:11 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653802..8654174 1..373 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:30 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4479524..4479896 1..373 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:14 Download gff for FI16919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8394633..8395005 1..373 100   Minus

FI16919.hyp Sequence

Translation from 2 to 298

> FI16919.hyp
QLYSRISAVSISDCQHINTTRMQKPHHGPCWMLLLLASLIGTFMLAFSYW
MFVPREESLWSMISNYSGSGIKYSLPPSAVPEELKLRQRPPFVYQILH*

FI16919.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42489-PB 77 CG42489-PB 1..77 22..98 419 100 Plus
CG42489-PC 77 CG42489-PC 1..77 22..98 419 100 Plus
CG42489-PA 77 CG42489-PA 1..77 22..98 419 100 Plus

FI16919.pep Sequence

Translation from 2 to 298

> FI16919.pep
QLYSRISAVSISDCQHINTTRMQKPHHGPCWMLLLLASLIGTFMLAFSYW
MFVPREESLWSMISNYSGSGIKYSLPPSAVPEELKLRQRPPFVYQILH*

FI16919.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16330-PA 78 GF16330-PA 1..78 22..98 283 70.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22887-PA 86 GH22887-PA 1..85 22..97 167 38.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42489-PB 77 CG42489-PB 1..77 22..98 419 100 Plus
CG42489-PC 77 CG42489-PC 1..77 22..98 419 100 Plus
CG42489-PA 77 CG42489-PA 1..77 22..98 419 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10231-PA 84 GI10231-PA 1..83 22..97 162 42.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24501-PA 78 GL24501-PA 1..78 22..98 246 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27303-PA 78 GA27303-PA 1..78 22..98 253 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26330-PA 79 GM26330-PA 1..79 22..98 358 89.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20855-PA 79 GD20855-PA 1..79 22..98 365 93.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11035-PA 84 GJ11035-PA 1..84 22..98 175 41.7 Plus