Clone FI17004 Report

Search the DGRC for FI17004

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:170
Well:4
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG1746-RF
Protein status:FI17004.pep: gold
Sequenced Size:759

Clone Sequence Records

FI17004.complete Sequence

759 bp assembled on 2011-11-30

GenBank Submission: BT132846.1

> FI17004.complete
GAGATAAAGTTAAAATGTGCAGGAAATTACATAATTATCGGAAAAGTGCA
TTGATTTTCCCGATCTAACCATTTGAATGCCGCCCTGGCGTGGTGAACTT
CCAATGGCCGCGTTCCTCGCCAACTCCAAGCAGTACTTGCGACCATTGAG
CAGCGCCATCATCAGCCAGAGCCAGACTTTGGCCGCTCAGAACACAACCC
CCGTTGCATTGCTGCCACAGATCAGGTCATTCCAGACCTCGCCAGTCACG
CGTGACATTGACTCGGCCGCCAAATTCATTGGTGCTGGTGCCGCAACAGT
CGGTGTCGCTGGATCCGGTGCTGGTATCGGAACAGTATTCGGTTCCCTCA
TCATCGGCTACGCCAGGAACCCATCGCTGAAACAGCAGCTGTTCTCCTAC
GCCATTCTGGGCTTCGCCCTGTCCGAGGCCATGGGTCTGTTCTGTTTGAT
GATGGCCTTCCTGCTGCTGTTCGCCTTCTAAGCGCGCCTGCTGCACATCG
ATTGCTCGTCCTTGTTTCCTGCGATCGGGCGCGTGCGCCAGTCGCATGCG
AACGAGAATAGCAACCAAACAACACTTCAAACAAACAAACAACAACAACA
ACCAGAACAAGCAACACCTACGTTCGTTTTCGATTATTAATGATAAAATG
ATTGATTGATTGATTGATAGCAAACAAGAACATCCTGTACAACTATCTAA
TTATAAATACCAACAACAACCACATAAGAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

FI17004.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27039157..27039564 727..317 1975 99.3 Minus
chr3R 27901430 chr3R 27040124..27040331 319..112 1040 100 Minus
chr3R 27901430 chr3R 27041179..27041290 112..1 560 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31216768..31217178 727..317 2055 100 Minus
3R 32079331 3R 31217738..31217945 319..112 1040 100 Minus
3R 32079331 3R 31218793..31218904 112..1 560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30957599..30958009 727..317 2055 100 Minus
3R 31820162 3R 30958569..30958776 319..112 1040 100 Minus
3R 31820162 3R 30959624..30959735 112..1 560 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:47:01 has no hits.

FI17004.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:47:57 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27039156..27039563 318..728 94 <- Minus
chr3R 27040126..27040330 113..317 100 <- Minus
chr3R 27041179..27041290 1..112 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-30 09:42:18 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
CG1746-RF 1..405 77..481 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:35 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
CG1746-RF 1..405 77..481 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:42:27 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
CG1746-RF 1..405 77..481 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-30 09:42:18 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
CG1746-RF 1..727 1..728 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:35 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
CG1746-RF 1..727 1..728 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:42:27 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
CG1746-RF 1..727 1..728 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:57 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31216767..31217177 318..728 99 <- Minus
3R 31217740..31217944 113..317 100 <- Minus
3R 31218793..31218904 1..112 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:57 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31216767..31217177 318..728 99 <- Minus
3R 31217740..31217944 113..317 100 <- Minus
3R 31218793..31218904 1..112 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:57 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31216767..31217177 318..728 99 <- Minus
3R 31217740..31217944 113..317 100 <- Minus
3R 31218793..31218904 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:35 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27042489..27042899 318..728 99 <- Minus
arm_3R 27043462..27043666 113..317 100 <- Minus
arm_3R 27044515..27044626 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:40:35 Download gff for FI17004.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30958571..30958775 113..317 100 <- Minus
3R 30959624..30959735 1..112 100   Minus
3R 30957598..30958008 318..728 99 <- Minus

FI17004.pep Sequence

Translation from 76 to 480

> FI17004.pep
MPPWRGELPMAAFLANSKQYLRPLSSAIISQSQTLAAQNTTPVALLPQIR
SFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPS
LKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF*

FI17004.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16589-PA 138 GF16589-PA 15..138 11..134 608 97.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11879-PA 138 GG11879-PA 15..138 11..134 614 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14335-PA 138 GH14335-PA 15..138 11..134 608 97.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynC-PF 134 CG1746-PF 1..134 1..134 665 100 Plus
ATPsynC-PG 138 CG1746-PG 15..138 11..134 600 99.2 Plus
ATPsynC-PE 138 CG1746-PE 15..138 11..134 600 99.2 Plus
ATPsynC-PB 138 CG1746-PB 15..138 11..134 600 99.2 Plus
ATPsynC-PC 138 CG1746-PC 15..138 11..134 600 99.2 Plus
ATPsynC-PA 138 CG1746-PA 15..138 11..134 600 99.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10430-PA 138 GI10430-PA 16..138 12..134 607 98.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13949-PA 138 GL13949-PA 15..138 11..134 608 97.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14517-PE 138 GA14517-PE 15..138 11..134 608 97.6 Plus
Dpse\GA14517-PD 138 GA14517-PD 15..138 11..134 608 97.6 Plus
Dpse\GA14517-PC 138 GA14517-PC 15..138 11..134 608 97.6 Plus
Dpse\GA14517-PB 138 GA14517-PB 15..138 11..134 608 97.6 Plus
Dpse\GA14517-PA 138 GA14517-PA 15..138 11..134 608 97.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12097-PA 138 GM12097-PA 15..138 11..134 607 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16524-PA 115 GD16524-PA 15..115 11..134 439 76.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10646-PA 138 GJ10646-PA 18..138 14..134 604 99.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22551-PA 138 GK22551-PA 15..138 11..134 607 97.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23327-PA 138 GE23327-PA 16..138 12..134 608 99.2 Plus

FI17004.hyp Sequence

Translation from 76 to 480

> FI17004.hyp
MPPWRGELPMAAFLANSKQYLRPLSSAIISQSQTLAAQNTTPVALLPQIR
SFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPS
LKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF*

FI17004.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG1746-PF 134 CG1746-PF 1..134 1..134 665 100 Plus
CG1746-PG 138 CG1746-PG 15..138 11..134 600 99.2 Plus
CG1746-PE 138 CG1746-PE 15..138 11..134 600 99.2 Plus
CG1746-PB 138 CG1746-PB 15..138 11..134 600 99.2 Plus
CG1746-PC 138 CG1746-PC 15..138 11..134 600 99.2 Plus