Clone FI17037 Report

Search the DGRC for FI17037

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:170
Well:37
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG8138-RA
Protein status:FI17037.pep: gold
Sequenced Size:821

Clone Sequence Records

FI17037.complete Sequence

821 bp assembled on 2011-11-23

GenBank Submission: BT132810.1

> FI17037.complete
ACTTTTGTAGAAAACGATTAGGTGCTAAAATATTTGCTCATCATGACAGA
CTTCAGCATTGCCAAGTTTAACAACTATCAGGAGTATCTGCACTCCTTTA
CGACCGTCGAGGACTTTCGGTACTTACCTTTCCACAAAACGGTCATTACT
CTCACAAAACTCGGCTATCGGGAACACCGCACTTTCTACGAGGAGGATGA
GTTCTTAAACGTGAAAAAGCAGGTGGAACAGCTCCTGAATCCAACGGTTT
CTGCCCAGATATACTACAGTCAGTACTTCAAGGGAACCGATCCAGCACTT
TGGGCATTGGCCGAACGCGAGCACGGGAATGTCCAGCAGGAGATATCGAC
CATTATCTTTCTGGAAATAAGCGGACGAAGTGGGTTCTCCAAGTCAGGCT
ACATTGACTTTGAGGCCAGTCTGCGAAACTACCGGTTCAAGGGACCAAAT
GCAGTCGATTGGAAGGCGGTTTTCGAGGAGCGGAAGTTGCTGAAGCCCCA
GCCGAGTGATATAGTCTTCTACGACTGGAAGACCAGGAAGATTTTTGCGA
ATGACAACGACAATTATACGGTGGTAGCTCATCCGGAACATGGTCTTATG
TTTGCTCACAAGGGAGATCACAAGAACATACCCGTTACCACCAAGAAGAA
CCCCTTTTCCAGCAACGTTAGACGCTCTATGATCAGGTCAAATCTATATG
GTTTCATTATACTGTACGACCACCACGTTCGTAAGAAGACTTAGATTATG
TTCAACTAATGTTTTGGCGAGCAATGAATATAAATTTAAATATTGAAAAA
AAAAAAAAAAAAAAAAAAAAA

FI17037.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9006823..9007270 348..795 2240 100 Plus
chr3R 27901430 chr3R 9006420..9006767 1..348 1710 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13181707..13182154 348..795 2240 100 Plus
3R 32079331 3R 13181304..13181651 1..348 1740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12922538..12922985 348..795 2240 100 Plus
3R 31820162 3R 12922135..12922482 1..348 1740 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:29:21 has no hits.

FI17037.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:30:13 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9006420..9006767 1..348 99 -> Plus
chr3R 9006824..9007270 349..795 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:34:00 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
CG8138-RA 1..702 43..744 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:20 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
CG8138-RA 1..702 43..744 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:18 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
CG8138-RA 1..702 43..744 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:33:59 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
CG8138-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:20 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
CG8138-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:18 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
CG8138-RA 1..795 1..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:13 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13181304..13181651 1..348 100 -> Plus
3R 13181708..13182154 349..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:13 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13181304..13181651 1..348 100 -> Plus
3R 13181708..13182154 349..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:13 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13181304..13181651 1..348 100 -> Plus
3R 13181708..13182154 349..795 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:20 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9007026..9007373 1..348 100 -> Plus
arm_3R 9007430..9007876 349..795 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:32 Download gff for FI17037.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12922135..12922482 1..348 100 -> Plus
3R 12922539..12922985 349..795 100   Plus

FI17037.hyp Sequence

Translation from 42 to 743

> FI17037.hyp
MTDFSIAKFNNYQEYLHSFTTVEDFRYLPFHKTVITLTKLGYREHRTFYE
EDEFLNVKKQVEQLLNPTVSAQIYYSQYFKGTDPALWALAEREHGNVQQE
ISTIIFLEISGRSGFSKSGYIDFEASLRNYRFKGPNAVDWKAVFEERKLL
KPQPSDIVFYDWKTRKIFANDNDNYTVVAHPEHGLMFAHKGDHKNIPVTT
KKNPFSSNVRRSMIRSNLYGFIILYDHHVRKKT*

FI17037.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8138-PA 233 CG8138-PA 1..233 1..233 1243 100 Plus
CG14013-PA 241 CG14013-PA 9..240 3..232 392 36.6 Plus
CG14017-PA 238 CG14017-PA 26..237 12..232 324 33.9 Plus
CG3528-PA 235 CG3528-PA 2..233 5..231 319 31 Plus

FI17037.pep Sequence

Translation from 42 to 743

> FI17037.pep
MTDFSIAKFNNYQEYLHSFTTVEDFRYLPFHKTVITLTKLGYREHRTFYE
EDEFLNVKKQVEQLLNPTVSAQIYYSQYFKGTDPALWALAEREHGNVQQE
ISTIIFLEISGRSGFSKSGYIDFEASLRNYRFKGPNAVDWKAVFEERKLL
KPQPSDIVFYDWKTRKIFANDNDNYTVVAHPEHGLMFAHKGDHKNIPVTT
KKNPFSSNVRRSMIRSNLYGFIILYDHHVRKKT*

FI17037.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17583-PA 233 GF17583-PA 1..233 1..233 1124 88.8 Plus
Dana\GF14314-PA 240 GF14314-PA 7..240 2..233 409 37.2 Plus
Dana\GF20603-PA 235 GF20603-PA 6..233 9..231 358 34.9 Plus
Dana\GF15571-PA 282 GF15571-PA 70..281 12..232 306 32.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19478-PA 233 GG19478-PA 1..233 1..233 1229 97.4 Plus
Dere\GG24295-PA 241 GG24295-PA 8..241 2..233 391 36.3 Plus
Dere\GG25082-PA 245 GG25082-PA 33..245 12..233 345 35.1 Plus
Dere\GG24513-PA 235 GG24513-PA 1..233 4..231 302 30 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13001-PA 233 GH13001-PA 4..233 3..233 529 45.5 Plus
Dgri\GH11496-PA 235 GH11496-PA 1..233 4..231 351 32.5 Plus
Dgri\GH13002-PA 169 GH13002-PA 2..167 63..231 345 42 Plus
Dgri\GH10702-PA 239 GH10702-PA 5..238 1..232 341 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8138-PA 233 CG8138-PA 1..233 1..233 1243 100 Plus
CG14013-PA 241 CG14013-PA 9..240 3..232 392 36.6 Plus
CG14017-PA 238 CG14017-PA 26..237 12..232 324 33.9 Plus
CG3528-PA 235 CG3528-PA 2..233 5..231 319 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17674-PA 235 GI17674-PA 6..235 3..233 547 48.5 Plus
Dmoj\GI10061-PA 256 GI10061-PA 5..203 2..201 485 45.5 Plus
Dmoj\GI17675-PA 229 GI17675-PA 5..229 2..233 479 42.2 Plus
Dmoj\GI11263-PA 239 GI11263-PA 7..239 3..233 376 35.6 Plus
Dmoj\GI16993-PA 229 GI16993-PA 1..227 4..231 319 32.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24395-PA 233 GL24395-PA 1..233 1..233 897 68.7 Plus
Dper\GL26647-PA 238 GL26647-PA 6..238 2..233 376 34.7 Plus
Dper\GL26367-PA 223 GL26367-PA 4..222 5..232 362 36.8 Plus
Dper\GL26464-PA 236 GL26464-PA 1..234 4..231 334 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20845-PA 233 GA20845-PA 1..233 1..233 890 67.8 Plus
Dpse\GA29003-PA 238 GA29003-PA 6..238 2..233 379 34.7 Plus
Dpse\GA12701-PA 223 GA12701-PA 4..222 5..232 356 36.4 Plus
Dpse\GA17502-PA 236 GA17502-PA 1..234 4..231 330 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24088-PA 233 GM24088-PA 1..233 1..233 1239 98.7 Plus
Dsec\GM18012-PA 241 GM18012-PA 8..241 2..233 386 35.9 Plus
Dsec\GM18221-PA 309 GM18221-PA 1..195 4..194 268 30.3 Plus
Dsec\GM18558-PA 129 GM18558-PA 1..128 103..232 244 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18886-PA 233 GD18886-PA 1..233 1..233 1242 99.1 Plus
Dsim\GD23351-PA 238 GD23351-PA 26..237 12..232 325 33.9 Plus
Dsim\GD22828-PA 235 GD22828-PA 1..233 4..231 309 30 Plus
Dsim\GD22646-PA 109 GD22646-PA 2..109 126..233 206 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18363-PA 227 GJ18363-PA 2..227 3..230 580 48.7 Plus
Dvir\GJ17870-PA 234 GJ17870-PA 6..232 3..231 506 45.4 Plus
Dvir\GJ17871-PA 338 GJ17871-PA 6..225 3..223 487 45.7 Plus
Dvir\GJ12400-PA 239 GJ12400-PA 5..239 1..233 371 34.5 Plus
Dvir\GJ24171-PA 217 GJ24171-PA 1..215 4..231 300 30.7 Plus
Dvir\GJ17871-PA 338 GJ17871-PA 210..336 102..231 265 43.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16731-PA 233 GK16731-PA 1..232 1..232 638 52.6 Plus
Dwil\GK16455-PA 236 GK16455-PA 7..229 3..229 551 46.5 Plus
Dwil\GK15432-PA 242 GK15432-PA 9..242 2..233 394 35.9 Plus
Dwil\GK23733-PA 236 GK23733-PA 6..234 9..231 350 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26250-PA 233 GE26250-PA 1..233 1..233 1237 97.9 Plus
Dyak\GE18991-PA 241 GE18991-PA 8..241 2..233 385 35.5 Plus
Dyak\GE25504-PA 229 GE25504-PA 17..228 12..232 337 33.9 Plus
Dyak\GE15089-PA 235 GE15089-PA 1..233 4..231 314 30.9 Plus