Clone FI17101 Report

Search the DGRC for FI17101

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:171
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG15881-RA
Protein status:FI17101.pep: gold
Sequenced Size:657

Clone Sequence Records

FI17101.complete Sequence

657 bp assembled on 2011-11-23

GenBank Submission: BT132832.1

> FI17101.complete
CAGAGGCACATTGCGCCGGCAATTTTACATATATCATTTTGTTTTTATTA
TTTTTTAAAGTGTTTTCTTGTTTTCCTACCTGGTTTAAATGGCGGCATTG
TGCTTAGACTTTCTCGGCTTCCAGGAGGCACTGAAGAAGATGCGAGATGT
GGACGACAAGATTATATATGCACTAAATGCCCTGCCAACGGAGTCGTTTA
AGGGTCAAGTGAACAGTGAAAGCACCTGTCGCGATCTGTACGCGAAGCTC
CAGGAGTCACACTTGGCCAGGCAAGAAAGCATACGCAGTTGCATAACAAT
TTCGGCTAGTAATCTGAAGAAGCTAAGGGAAAAGCGGGAGACCCAGCCGG
ATGATGTGGATACGGATAACCAGTTTAGGGCGGAGCAGCGCAAGCTGCGG
GTTCTCCAGGCCGAGCTCAATGTCGAGGACATCATTAAAGATCGTTCCTA
CAAGACCTTCAATGAACGATGCCGGTCCTATTTTCATGCTGGCCAATAGG
TGGAACAAATGCAATGACTAGTTTTAGGTGGATTTATTAGCAGAAGTCTC
ATGGAACTGCCAAGCCAGAAGGCATTTACATGCACTCCGTTGTATTACAA
GTTGTTTACAACAAGTACATAAATATAACAGTCTAAAAACCAAAAAAAAA
AAAAAAA

FI17101.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19796061..19796307 393..639 1220 99.6 Plus
chr3L 24539361 chr3L 19795680..19795829 122..271 750 100 Plus
chr3L 24539361 chr3L 19795492..19795615 2..125 620 100 Plus
chr3L 24539361 chr3L 19795886..19796009 271..394 620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19806684..19806937 393..646 1240 99.2 Plus
3L 28110227 3L 19806303..19806452 122..271 750 100 Plus
3L 28110227 3L 19806115..19806238 2..125 620 100 Plus
3L 28110227 3L 19806509..19806632 271..394 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19799784..19800037 393..646 1240 99.2 Plus
3L 28103327 3L 19799403..19799552 122..271 750 100 Plus
3L 28103327 3L 19799609..19799732 271..394 620 100 Plus
3L 28103327 3L 19799215..19799338 2..125 620 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:27:38 has no hits.

FI17101.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:28:19 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19795491..19795614 1..124 99 -> Plus
chr3L 19795683..19795829 125..271 100 -> Plus
chr3L 19795887..19796009 272..394 100 -> Plus
chr3L 19796063..19796309 395..641 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:41 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RA 1..411 89..499 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:36 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RA 1..411 89..499 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:18 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RA 1..411 89..499 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:41 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RA 2..641 2..641 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:36 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RA 20..660 1..641 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:18 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15881-RA 20..660 1..641 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:19 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806114..19806237 1..124 99 -> Plus
3L 19806306..19806452 125..271 100 -> Plus
3L 19806510..19806632 272..394 100 -> Plus
3L 19806686..19806932 395..641 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:19 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806114..19806237 1..124 99 -> Plus
3L 19806306..19806452 125..271 100 -> Plus
3L 19806510..19806632 272..394 100 -> Plus
3L 19806686..19806932 395..641 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:19 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806114..19806237 1..124 99 -> Plus
3L 19806306..19806452 125..271 100 -> Plus
3L 19806510..19806632 272..394 100 -> Plus
3L 19806686..19806932 395..641 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:36 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19799406..19799552 125..271 100 -> Plus
arm_3L 19799610..19799732 272..394 100 -> Plus
arm_3L 19799786..19800032 395..641 99   Plus
arm_3L 19799214..19799337 1..124 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:15 Download gff for FI17101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19799786..19800032 395..641 99   Plus
3L 19799214..19799337 1..124 99 -> Plus
3L 19799406..19799552 125..271 100 -> Plus
3L 19799610..19799732 272..394 100 -> Plus

FI17101.hyp Sequence

Translation from 88 to 498

> FI17101.hyp
MAALCLDFLGFQEALKKMRDVDDKIIYALNALPTESFKGQVNSESTCRDL
YAKLQESHLARQESIRSCITISASNLKKLREKRETQPDDVDTDNQFRAEQ
RKLRVLQAELNVEDIIKDRSYKTFNERCRSYFHAGQ*

FI17101.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15881-PA 136 CG15881-PA 1..136 1..136 693 100 Plus
CG15881-PC 119 CG15881-PC 1..119 18..136 607 100 Plus
CG15881-PB 119 CG15881-PB 1..119 18..136 607 100 Plus

FI17101.pep Sequence

Translation from 88 to 498

> FI17101.pep
MAALCLDFLGFQEALKKMRDVDDKIIYALNALPTESFKGQVNSESTCRDL
YAKLQESHLARQESIRSCITISASNLKKLREKRETQPDDVDTDNQFRAEQ
RKLRVLQAELNVEDIIKDRSYKTFNERCRSYFHAGQ*

FI17101.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23593-PA 136 GF23593-PA 1..136 1..136 630 83.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16058-PA 136 GG16058-PA 1..136 1..136 694 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14656-PA 136 GH14656-PA 1..136 1..136 623 83.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ccdc58-PA 136 CG15881-PA 1..136 1..136 693 100 Plus
Ccdc58-PC 119 CG15881-PC 1..119 18..136 607 100 Plus
Ccdc58-PB 119 CG15881-PB 1..119 18..136 607 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11642-PA 136 GI11642-PA 1..136 1..136 628 84.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15734-PA 136 GL15734-PA 1..136 1..136 604 81.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14002-PA 136 GA14002-PA 1..136 1..136 608 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19650-PA 136 GM19650-PA 1..136 1..136 709 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14828-PA 136 GD14828-PA 1..136 1..136 712 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11323-PA 136 GJ11323-PA 1..136 1..136 636 85.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17498-PA 137 GK17498-PA 1..137 1..136 604 81 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19624-PA 136 GE19624-PA 1..136 1..136 691 96.3 Plus