BDGP Sequence Production Resources |
Search the DGRC for FI17101
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 171 |
Well: | 1 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG15881-RA |
Protein status: | FI17101.pep: gold |
Sequenced Size: | 657 |
657 bp assembled on 2011-11-23
GenBank Submission: BT132832.1
> FI17101.complete CAGAGGCACATTGCGCCGGCAATTTTACATATATCATTTTGTTTTTATTA TTTTTTAAAGTGTTTTCTTGTTTTCCTACCTGGTTTAAATGGCGGCATTG TGCTTAGACTTTCTCGGCTTCCAGGAGGCACTGAAGAAGATGCGAGATGT GGACGACAAGATTATATATGCACTAAATGCCCTGCCAACGGAGTCGTTTA AGGGTCAAGTGAACAGTGAAAGCACCTGTCGCGATCTGTACGCGAAGCTC CAGGAGTCACACTTGGCCAGGCAAGAAAGCATACGCAGTTGCATAACAAT TTCGGCTAGTAATCTGAAGAAGCTAAGGGAAAAGCGGGAGACCCAGCCGG ATGATGTGGATACGGATAACCAGTTTAGGGCGGAGCAGCGCAAGCTGCGG GTTCTCCAGGCCGAGCTCAATGTCGAGGACATCATTAAAGATCGTTCCTA CAAGACCTTCAATGAACGATGCCGGTCCTATTTTCATGCTGGCCAATAGG TGGAACAAATGCAATGACTAGTTTTAGGTGGATTTATTAGCAGAAGTCTC ATGGAACTGCCAAGCCAGAAGGCATTTACATGCACTCCGTTGTATTACAA GTTGTTTACAACAAGTACATAAATATAACAGTCTAAAAACCAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 19796061..19796307 | 393..639 | 1220 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 19795680..19795829 | 122..271 | 750 | 100 | Plus |
chr3L | 24539361 | chr3L | 19795492..19795615 | 2..125 | 620 | 100 | Plus |
chr3L | 24539361 | chr3L | 19795886..19796009 | 271..394 | 620 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 19806684..19806937 | 393..646 | 1240 | 99.2 | Plus |
3L | 28110227 | 3L | 19806303..19806452 | 122..271 | 750 | 100 | Plus |
3L | 28110227 | 3L | 19806115..19806238 | 2..125 | 620 | 100 | Plus |
3L | 28110227 | 3L | 19806509..19806632 | 271..394 | 620 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 19799784..19800037 | 393..646 | 1240 | 99.2 | Plus |
3L | 28103327 | 3L | 19799403..19799552 | 122..271 | 750 | 100 | Plus |
3L | 28103327 | 3L | 19799609..19799732 | 271..394 | 620 | 100 | Plus |
3L | 28103327 | 3L | 19799215..19799338 | 2..125 | 620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 19795491..19795614 | 1..124 | 99 | -> | Plus |
chr3L | 19795683..19795829 | 125..271 | 100 | -> | Plus |
chr3L | 19795887..19796009 | 272..394 | 100 | -> | Plus |
chr3L | 19796063..19796309 | 395..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15881-RA | 1..411 | 89..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15881-RA | 1..411 | 89..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15881-RA | 1..411 | 89..499 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15881-RA | 2..641 | 2..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15881-RA | 20..660 | 1..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15881-RA | 20..660 | 1..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19806114..19806237 | 1..124 | 99 | -> | Plus |
3L | 19806306..19806452 | 125..271 | 100 | -> | Plus |
3L | 19806510..19806632 | 272..394 | 100 | -> | Plus |
3L | 19806686..19806932 | 395..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19806114..19806237 | 1..124 | 99 | -> | Plus |
3L | 19806306..19806452 | 125..271 | 100 | -> | Plus |
3L | 19806510..19806632 | 272..394 | 100 | -> | Plus |
3L | 19806686..19806932 | 395..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19806114..19806237 | 1..124 | 99 | -> | Plus |
3L | 19806306..19806452 | 125..271 | 100 | -> | Plus |
3L | 19806510..19806632 | 272..394 | 100 | -> | Plus |
3L | 19806686..19806932 | 395..641 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 19799406..19799552 | 125..271 | 100 | -> | Plus |
arm_3L | 19799610..19799732 | 272..394 | 100 | -> | Plus |
arm_3L | 19799786..19800032 | 395..641 | 99 | Plus | |
arm_3L | 19799214..19799337 | 1..124 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19799786..19800032 | 395..641 | 99 | Plus | |
3L | 19799214..19799337 | 1..124 | 99 | -> | Plus |
3L | 19799406..19799552 | 125..271 | 100 | -> | Plus |
3L | 19799610..19799732 | 272..394 | 100 | -> | Plus |
Translation from 88 to 498
> FI17101.hyp MAALCLDFLGFQEALKKMRDVDDKIIYALNALPTESFKGQVNSESTCRDL YAKLQESHLARQESIRSCITISASNLKKLREKRETQPDDVDTDNQFRAEQ RKLRVLQAELNVEDIIKDRSYKTFNERCRSYFHAGQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15881-PA | 136 | CG15881-PA | 1..136 | 1..136 | 693 | 100 | Plus |
CG15881-PC | 119 | CG15881-PC | 1..119 | 18..136 | 607 | 100 | Plus |
CG15881-PB | 119 | CG15881-PB | 1..119 | 18..136 | 607 | 100 | Plus |
Translation from 88 to 498
> FI17101.pep MAALCLDFLGFQEALKKMRDVDDKIIYALNALPTESFKGQVNSESTCRDL YAKLQESHLARQESIRSCITISASNLKKLREKRETQPDDVDTDNQFRAEQ RKLRVLQAELNVEDIIKDRSYKTFNERCRSYFHAGQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23593-PA | 136 | GF23593-PA | 1..136 | 1..136 | 630 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16058-PA | 136 | GG16058-PA | 1..136 | 1..136 | 694 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14656-PA | 136 | GH14656-PA | 1..136 | 1..136 | 623 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ccdc58-PA | 136 | CG15881-PA | 1..136 | 1..136 | 693 | 100 | Plus |
Ccdc58-PC | 119 | CG15881-PC | 1..119 | 18..136 | 607 | 100 | Plus |
Ccdc58-PB | 119 | CG15881-PB | 1..119 | 18..136 | 607 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11642-PA | 136 | GI11642-PA | 1..136 | 1..136 | 628 | 84.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15734-PA | 136 | GL15734-PA | 1..136 | 1..136 | 604 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14002-PA | 136 | GA14002-PA | 1..136 | 1..136 | 608 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19650-PA | 136 | GM19650-PA | 1..136 | 1..136 | 709 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14828-PA | 136 | GD14828-PA | 1..136 | 1..136 | 712 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11323-PA | 136 | GJ11323-PA | 1..136 | 1..136 | 636 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17498-PA | 137 | GK17498-PA | 1..137 | 1..136 | 604 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19624-PA | 136 | GE19624-PA | 1..136 | 1..136 | 691 | 96.3 | Plus |