Clone FI17103 Report

Search the DGRC for FI17103

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:171
Well:3
Vector:pFlc-1
Associated Gene/TranscriptmRpS24-RA
Protein status:FI17103.pep: gold
Sequenced Size:595

Clone Sequence Records

FI17103.complete Sequence

595 bp assembled on 2011-11-23

GenBank Submission: BT132815.1

> FI17103.complete
AGCTGTTGCTGGACGCAAAATTGTTTCTGCCGCAAAATAATGAACTTCTT
GAAAAAGCTGTTGCCCCAGGTGGCGACCGAGGTGCAGCAGCTCAGCCGGT
CAGGATTCCACACCAGCTCCGTGTGCTGTCGCGTGCAATCCGGGCGATAC
CGCATAACCACAAAGCGAAACAGGCCTCTTACCTACGAGATGGCCAATCC
GCCGCATTTTATTGGCCACCGCAAATCGTGGAACTCATGGAACACGTCAA
CAATGAAGGATGCCCTGCGTCCGTCCCAGACCGCCATAGAGGATGTGTTC
ATCCGCAAGTTTGTCACCGGCACATGGCATGCCCTCGTCTGCTCCGAGGT
CATTATCAAGCGACAGCACAACACCATTAGGATCGCGGCCCTTATTCGGC
AGGCGATTACACCGCGAAAAATGTACTTCCTTATTGGTTACACGGAGGAG
CTGCTCTCCTATTGGATGCAGTGTCCAGTGACCTTGGAACTGCAAACGGT
GGGCGATAAAAAGGACGTGGTCTTCAAATACATTTAGTTCATTCTGCTAT
ATACATGTCCAATATAAAAGTGTAGATTTAAAAAAAAAAAAAAAA

FI17103.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19986159..19986490 579..248 1600 98.8 Minus
chr3R 27901430 chr3R 19986548..19986739 247..56 960 100 Minus
chr3R 27901430 chr3R 19986794..19986854 61..1 290 98.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24162828..24163160 580..248 1665 100 Minus
3R 32079331 3R 24163218..24163409 247..56 960 100 Minus
3R 32079331 3R 24163464..24163524 61..1 290 98.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23903659..23903991 580..248 1665 100 Minus
3R 31820162 3R 23904049..23904240 247..56 960 100 Minus
3R 31820162 3R 23904295..23904355 61..1 290 98.3 Minus
Blast to na_te.dros performed on 2019-03-15 11:28:22 has no hits.

FI17103.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:29:46 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19986159..19986490 248..579 98 <- Minus
chr3R 19986548..19986737 58..247 100 <- Minus
chr3R 19986798..19986854 1..57 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:42 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS24-RA 1..498 40..537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:40 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS24-RA 1..498 40..537 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:25 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS24-RA 1..498 40..537 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:42 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS24-RA 1..579 1..579 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:40 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS24-RA 22..600 1..579 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:25 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS24-RA 22..600 1..579 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:46 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24162829..24163160 248..579 100 <- Minus
3R 24163218..24163407 58..247 100 <- Minus
3R 24163468..24163524 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:46 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24162829..24163160 248..579 100 <- Minus
3R 24163218..24163407 58..247 100 <- Minus
3R 24163468..24163524 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:46 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24162829..24163160 248..579 100 <- Minus
3R 24163218..24163407 58..247 100 <- Minus
3R 24163468..24163524 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:40 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19988551..19988882 248..579 100 <- Minus
arm_3R 19988940..19989129 58..247 100 <- Minus
arm_3R 19989190..19989246 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:16 Download gff for FI17103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23903660..23903991 248..579 100 <- Minus
3R 23904049..23904238 58..247 100 <- Minus
3R 23904299..23904355 1..57 100   Minus

FI17103.hyp Sequence

Translation from 0 to 536

> FI17103.hyp
SCCWTQNCFCRKIMNFLKKLLPQVATEVQQLSRSGFHTSSVCCRVQSGRY
RITTKRNRPLTYEMANPPHFIGHRKSWNSWNTSTMKDALRPSQTAIEDVF
IRKFVTGTWHALVCSEVIIKRQHNTIRIAALIRQAITPRKMYFLIGYTEE
LLSYWMQCPVTLELQTVGDKKDVVFKYI*

FI17103.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS24-PA 165 CG13608-PA 1..165 14..178 873 100 Plus

FI17103.pep Sequence

Translation from 0 to 536

> FI17103.pep
SCCWTQNCFCRKIMNFLKKLLPQVATEVQQLSRSGFHTSSVCCRVQSGRY
RITTKRNRPLTYEMANPPHFIGHRKSWNSWNTSTMKDALRPSQTAIEDVF
IRKFVTGTWHALVCSEVIIKRQHNTIRIAALIRQAITPRKMYFLIGYTEE
LLSYWMQCPVTLELQTVGDKKDVVFKYI*

FI17103.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18891-PA 165 GF18891-PA 1..165 14..178 822 90.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12367-PA 165 GG12367-PA 1..165 14..178 884 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19088-PA 165 GH19088-PA 1..165 14..178 793 85.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS24-PA 165 CG13608-PA 1..165 14..178 873 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23426-PA 169 GI23426-PA 1..169 14..178 759 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24137-PA 166 GL24137-PA 1..166 14..178 785 85.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12401-PA 166 GA12401-PA 1..166 14..178 787 85.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23506-PA 165 GM23506-PA 1..165 14..178 879 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18316-PA 165 GD18316-PA 1..165 14..178 879 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14529-PA 169 GJ14529-PA 1..169 14..178 776 84 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12989-PA 165 GK12989-PA 1..165 14..178 784 84.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10822-PA 165 GE10822-PA 1..165 14..178 882 98.2 Plus