Clone FI17113 Report

Search the DGRC for FI17113

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:171
Well:13
Vector:pFlc-1
Associated Gene/TranscriptTwdlBeta-RA
Protein status:FI17113.pep: gold
Sequenced Size:727

Clone Sequence Records

FI17113.complete Sequence

727 bp assembled on 2011-11-23

GenBank Submission: BT132807.1

> FI17113.complete
AGCATCATTCGCAGCCGAACCATCGACATCAGCATGCAGACGCAGTGTAT
CCTCCTTCTCTTGGCCGCCAGTCTGGCCATATGTGTGGCGCGTCCGGAAC
CACCTAGATCGCGTTACGGACCGCCGCCACCGCCGGCTCCCCAAAAGGAA
TACGGTCCTCCGGCCCCGGCAGCACAGCCTCTACCCGTTTACGGACCACC
AGCCGCCTTCTACGGACCACCAGCCGCCTCGGAGGCGCTCGTGACCAAGA
ACGTGTACGTGCATGTGCCGCCAGAGGAGCCAGAGTTCTATCCGGCCTCG
TCGCCCATCCAGACGGCCGTTCCCAAGAAGCACTACAAGATCATCTTCAT
CAAGGCGCCCAACCCTCCGACCCCTGTGCGCCAGGTGCTCCCTCCTCCGG
TCCAGGATGAGCACAAGACCCTTGTGTATGTTCTGGTCAAGAAGCCCGAG
GAGCAGCAGCCCGTCATCCTGCCCGCTCCAGAGCCCACAGAGCCCAGCAA
GCCAGAGGTCTACTTCATCAAGTATAAGCAGCAGCAGGCCAAGCCGGCCA
CCCAGTACGGCCCACCACCGTCCGCCCCATCCGAGGAGTACGGAGCACCA
CCTGCCCCCCGCACCGTCGAGCAGTTCTAGTTTGTAGTGTCGTCTAGGTC
TACAGCCCATGAATGTAAATATTATTTATGATCGCTGCCATTAAAGAGAG
TTTAGAGAAAGCAAAAAAAAAAAAAAA

FI17113.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7749817..7750528 712..1 3530 99.7 Minus
chr2L 23010047 chr2L 7857777..7857881 519..415 180 78.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11862533..11863248 716..1 3565 99.9 Minus
2L 23513712 2L 7858705..7858809 519..415 180 78.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11863732..11864447 716..1 3565 99.8 Minus
2L 23513712 2L 7858865..7858898 359..326 155 97 Minus
2L 23513712 2L 7858767..7858809 457..415 140 88.3 Minus
Blast to na_te.dros performed on 2019-03-15 11:28:55 has no hits.

FI17113.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:30:04 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7749817..7750528 1..712 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 12:15:41 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlBeta-RA 1..597 34..630 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:06 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlBeta-RA 1..597 34..630 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:00 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlBeta-RA 1..597 34..630 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 12:15:41 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlBeta-RA 1..712 1..712 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:06 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlBeta-RA 5..716 1..712 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:00 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlBeta-RA 5..716 1..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:04 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11862537..11863248 1..712 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:04 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11862537..11863248 1..712 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:04 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11862537..11863248 1..712 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:06 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7750042..7750753 1..712 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:24 Download gff for FI17113.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11863736..11864447 1..712 99   Minus

FI17113.hyp Sequence

Translation from 0 to 629

> FI17113.hyp
SFIRSRTIDISMQTQCILLLLAASLAICVARPEPPRSRYGPPPPPAPQKE
YGPPAPAAQPLPVYGPPAAFYGPPAASEALVTKNVYVHVPPEEPEFYPAS
SPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQDEHKTLVYVLVKKPE
EQQPVILPAPEPTEPSKPEVYFIKYKQQQAKPATQYGPPPSAPSEEYGAP
PAPRTVEQF*

FI17113.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlBeta-PA 198 CG8986-PA 1..198 12..209 1072 100 Plus
TwdlE-PA 197 CG14534-PA 1..195 12..200 501 50.5 Plus
TwdlC-PA 360 CG14254-PA 68..239 34..191 336 44.9 Plus
TwdlT-PA 286 CG5812-PA 122..229 72..179 311 55.6 Plus
TwdlG-PC 278 CG14643-PC 92..213 64..179 223 41.8 Plus

FI17113.pep Sequence

Translation from 0 to 629

> FI17113.pep
SIIRSRTIDISMQTQCILLLLAASLAICVARPEPPRSRYGPPPPPAPQKE
YGPPAPAAQPLPVYGPPAAFYGPPAASEALVTKNVYVHVPPEEPEFYPAS
SPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQDEHKTLVYVLVKKPE
EQQPVILPAPEPTEPSKPEVYFIKYKQQQAKPATQYGPPPSAPSEEYGAP
PAPRTVEQF*

FI17113.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11806-PA 195 GF11806-PA 1..195 12..209 699 88.4 Plus
Dana\GF23268-PA 286 GF23268-PA 131..231 79..179 263 58.4 Plus
Dana\GF22833-PA 197 GF22833-PA 70..161 90..181 213 59.8 Plus
Dana\GF23265-PA 369 GF23265-PA 130..245 78..191 202 52.5 Plus
Dana\GF16822-PA 238 GF16822-PA 60..172 69..179 182 46.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22628-PA 198 GG22628-PA 1..198 12..209 932 97.5 Plus
Dere\GG11520-PA 282 GG11520-PA 125..225 79..179 265 58.4 Plus
Dere\GG23499-PA 197 GG23499-PA 1..161 12..181 231 50.6 Plus
Dere\GG11517-PA 360 GG11517-PA 84..239 49..191 198 45.6 Plus
Dere\GG11741-PA 269 GG11741-PA 104..204 81..179 184 48.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22882-PA 193 GH22882-PA 1..193 12..209 727 80.4 Plus
Dgri\GH18631-PA 293 GH18631-PA 137..237 79..179 253 56.4 Plus
Dgri\GH11556-PA 196 GH11556-PA 1..176 12..198 214 50.3 Plus
Dgri\GH18628-PA 365 GH18628-PA 127..242 78..191 207 50.4 Plus
Dgri\GH19057-PA 287 GH19057-PA 83..183 79..179 183 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Twdlbeta-PA 198 CG8986-PA 1..198 12..209 1072 100 Plus
TwdlE-PA 197 CG14534-PA 1..195 12..200 501 50.5 Plus
TwdlC-PA 360 CG14254-PA 68..239 34..191 336 44.9 Plus
TwdlT-PA 286 CG5812-PA 122..229 72..179 311 55.6 Plus
TwdlG-PC 278 CG14643-PC 92..213 64..179 223 41.8 Plus
TwdlG-PB 278 CG14643-PB 92..213 64..179 223 41.8 Plus
TwdlG-PA 278 CG14643-PA 92..213 64..179 223 41.8 Plus
TwdlF-PA 354 CG14639-PA 137..249 79..185 184 41.6 Plus
Twdlalpha-PA 388 CG32574-PA 139..268 45..176 178 33.3 Plus
TwdlV-PA 251 CG14640-PA 45..174 57..179 173 35.6 Plus
TwdlY-PA 247 CG32570-PA 66..183 71..185 172 35.6 Plus
CG9411-PA 993 CG9411-PA 6..196 10..204 166 30 Plus
CG9411-PA 993 CG9411-PA 131..246 32..203 166 31.5 Plus
CG10953-PB 278 CG10953-PB 80..243 43..203 165 31.7 Plus
CG10953-PA 278 CG10953-PA 80..243 43..203 165 31.7 Plus
CG15021-PA 420 CG15021-PA 200..393 31..201 164 31.2 Plus
TwdlZ-PB 210 CG32569-PB 23..142 64..185 163 32 Plus
CG15022-PA 295 CG15022-PA 99..246 32..203 161 31.7 Plus
Muc91C-PB 949 CG7709-PB 335..494 32..200 160 31.7 Plus
Muc91C-PA 950 CG7709-PA 336..495 32..200 160 31.7 Plus
Muc91C-PA 950 CG7709-PA 93..266 12..203 157 29.6 Plus
CG13722-PB 708 CG13722-PB 249..457 29..208 157 28.8 Plus
Muc91C-PB 949 CG7709-PB 104..265 20..203 156 29.9 Plus
Muc91C-PB 949 CG7709-PB 375..563 32..200 156 30.2 Plus
Muc91C-PA 950 CG7709-PA 376..564 32..200 156 30.2 Plus
CG13722-PB 708 CG13722-PB 209..400 32..208 156 28 Plus
CG15021-PA 420 CG15021-PA 70..228 34..203 154 28.9 Plus
Muc91C-PB 949 CG7709-PB 315..470 32..201 154 31.6 Plus
Muc91C-PA 950 CG7709-PA 316..471 32..201 154 31.6 Plus
CG9411-PA 993 CG9411-PA 448..659 32..203 152 28.1 Plus
CG15021-PA 420 CG15021-PA 128..303 31..201 152 29 Plus
CG13722-PB 708 CG13722-PB 351..507 30..201 152 29.9 Plus
CG10953-PB 278 CG10953-PB 24..158 50..203 150 32.1 Plus
CG10953-PA 278 CG10953-PA 24..158 50..203 150 32.1 Plus
CG15021-PA 420 CG15021-PA 86..245 32..203 150 28.9 Plus
CG13722-PB 708 CG13722-PB 450..629 29..201 150 27.4 Plus
CG13722-PB 708 CG13722-PB 420..581 32..201 148 30.1 Plus
BOD1-PC 1109 CG5514-PC 358..493 32..207 148 32.4 Plus
BOD1-PA 1109 CG5514-PA 358..493 32..207 148 32.4 Plus
BOD1-PD 1150 CG5514-PD 358..493 32..207 148 32.4 Plus
BOD1-PB 1150 CG5514-PB 358..493 32..207 148 32.4 Plus
BOD1-PE 1151 CG5514-PE 358..493 32..207 148 32.4 Plus
CG32241-PB 415 CG32241-PB 157..341 32..201 147 30.7 Plus
CG15021-PA 420 CG15021-PA 171..338 31..203 146 29.6 Plus
CG32241-PB 415 CG32241-PB 104..296 29..201 146 27.5 Plus
CG15022-PA 295 CG15022-PA 171..286 32..172 145 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21267-PA 201 GI21267-PA 1..201 12..209 770 83.7 Plus
Dmoj\GI17047-PA 196 GI17047-PA 1..159 12..179 240 48.8 Plus
Dmoj\GI24299-PA 357 GI24299-PA 1..235 12..191 202 36.9 Plus
Dmoj\GI10848-PA 268 GI10848-PA 85..184 80..179 177 35 Plus
Dmoj\GI21932-PA 273 GI21932-PA 94..195 80..179 175 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10248-PA 181 GL10248-PA 70..181 80..209 455 79.2 Plus
Dper\GL23893-PA 392 GL23893-PA 127..276 55..191 254 46.4 Plus
Dper\GL19485-PA 197 GL19485-PA 1..159 12..179 231 47 Plus
Dper\GL23896-PA 263 GL23896-PA 130..218 79..167 207 52.8 Plus
Dper\GL12334-PA 296 GL12334-PA 130..231 80..179 188 49.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21455-PA 197 GA21455-PA 70..197 80..209 549 90 Plus
Dpse\GA19149-PA 293 GA19149-PA 130..230 79..179 261 57.4 Plus
Dpse\GA25978-PA 197 GA25978-PA 1..159 12..179 236 49.4 Plus
Dpse\GA22498-PA 375 GA22498-PA 108..257 55..191 216 47 Plus
Dpse\GA27091-PA 375 GA27091-PA 108..257 55..191 216 47 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20406-PA 196 GM20406-PA 47..196 60..209 724 99.3 Plus
Dsec\GM13288-PA 197 GM13288-PA 1..177 12..198 281 50.5 Plus
Dsec\GM10360-PA 281 GM10360-PA 116..220 79..183 250 55.2 Plus
Dsec\GM10357-PA 360 GM10357-PA 1..239 12..191 198 38.3 Plus
Dsec\GM10719-PA 281 GM10719-PA 116..216 81..179 183 48.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25881-PA 198 GD25881-PA 1..198 12..209 954 99.5 Plus
Dsim\GD22462-PA 197 GD22462-PA 1..161 12..181 278 52.4 Plus
Dsim\GD21319-PA 360 GD21319-PA 84..239 49..191 197 45.6 Plus
Dsim\GD19694-PA 278 GD19694-PA 113..213 81..179 185 48.1 Plus
Dsim\GD19711-PA 255 GD19711-PA 81..178 79..179 173 37.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20869-PA 197 GJ20869-PA 1..197 12..209 643 79.3 Plus
Dvir\GJ23081-PA 283 GJ23081-PA 129..229 79..179 263 58.4 Plus
Dvir\GJ23078-PA 369 GJ23078-PA 130..245 78..191 214 52.1 Plus
Dvir\GJ10078-PA 196 GJ10078-PA 1..176 12..198 209 48.7 Plus
Dvir\GJ14291-PA 281 GJ14291-PA 112..213 80..179 175 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17917-PA 195 GK17917-PA 1..195 12..209 742 80.5 Plus
Dwil\GK11039-PA 272 GK11039-PA 115..215 79..179 263 58.4 Plus
Dwil\GK23969-PA 196 GK23969-PA 1..176 12..198 231 49.2 Plus
Dwil\GK13401-PA 428 GK13401-PA 257..357 83..176 198 52.4 Plus
Dwil\GK22650-PA 292 GK22650-PA 120..221 80..179 177 49.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13497-PA 198 GE13497-PA 1..198 12..209 949 99 Plus
Dyak\GE23709-PA 275 GE23709-PA 122..222 79..179 263 58.4 Plus
Dyak\GE18328-PA 197 GE18328-PA 1..161 12..181 230 50.6 Plus
Dyak\GE23705-PA 360 GE23705-PA 84..239 49..191 197 45.6 Plus
Dyak\GE25368-PA 265 GE25368-PA 97..200 78..179 172 43.9 Plus