Clone FI17116 Report

Search the DGRC for FI17116

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:171
Well:16
Vector:pFlc-1
Associated Gene/TranscriptFK506-bp2-RA
Protein status:FI17116.pep: gold
Sequenced Size:647

Clone Sequence Records

FI17116.complete Sequence

647 bp assembled on 2011-11-23

GenBank Submission: BT132803.1

> FI17116.complete
GTCATTCGGCGACGCGACGAACTGAAATCAACGTGCTTATTTTCCGCTCG
GTAATTTGCCAGAAAAAAACTAATCGAAATGGGCGTACAAGTAGTTCCAA
TTGCTCCTGGTGATGGCAGCACCTATCCCAAGAATGGCCAAAAGGTCACG
GTCCACTACACCGGCACCCTGGACGATGGCACCAAGTTCGATTCGTCGCG
CGACCGCAACAAGCCATTCAAGTTCACCATCGGCAAGGGCGAGGTCATCC
GTGGCTGGGATGAGGGAGTTGCCCAGTTGAGCGTCGGCCAGCGCGCCAAG
CTGATTTGCTCGCCGGACTATGCCTACGGTAGCCGTGGCCACCCCGGCGT
CATTCCGCCCAACTCCACCCTCACCTTCGACGTCGAGCTGCTCAAGGTCG
AATAGGCGCACAGGATGCCCAATGTGTATACCCCAAACCAAATCGCAGGG
GGTTGCGGACCGGCGCACCGGCGACGAGCCGAAGAACATCATAATCGGAA
CCAGAACAATCCAGCAGCATTTGCCAACCCAAAATAATAATGATAACTTC
ATACACAGCTCTAAACTAGAACTAATTTAACCGCAAAGGGAACGCATCTT
CTACCAATACAAATAAAACATTTATTCAAGTCAAAAAAAAAAAAAAA

FI17116.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15177684..15178130 185..632 2190 99.8 Plus
chr2R 21145070 chr2R 15177279..15177394 1..116 580 100 Plus
chr2R 21145070 chr2R 15177553..15177624 115..186 360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19290516..19290964 185..634 2200 99.8 Plus
2R 25286936 2R 19290111..19290226 1..116 580 100 Plus
2R 25286936 2R 19290385..19290456 115..186 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19291715..19292163 185..634 2210 99.7 Plus
2R 25260384 2R 19291310..19291425 1..116 580 100 Plus
2R 25260384 2R 19291584..19291655 115..186 360 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:28:34 has no hits.

FI17116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:29:53 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15177279..15177393 1..115 100 -> Plus
chr2R 15177554..15177624 116..186 100 -> Plus
chr2R 15177686..15178130 187..632 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-23 09:31:43 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 1..327 79..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:46 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 1..327 79..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:35:37 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 1..327 79..405 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-23 09:31:43 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 7..637 1..632 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:46 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 3..633 1..632 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:35:37 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 3..633 1..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:53 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19290111..19290225 1..115 100 -> Plus
2R 19290386..19290456 116..186 100 -> Plus
2R 19290518..19290962 187..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:53 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19290111..19290225 1..115 100 -> Plus
2R 19290386..19290456 116..186 100 -> Plus
2R 19290518..19290962 187..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:29:53 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19290111..19290225 1..115 100 -> Plus
2R 19290386..19290456 116..186 100 -> Plus
2R 19290518..19290962 187..632 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:46 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15177616..15177730 1..115 100 -> Plus
arm_2R 15177891..15177961 116..186 100 -> Plus
arm_2R 15178023..15178467 187..632 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:39:17 Download gff for FI17116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19291717..19292161 187..632 99   Plus
2R 19291310..19291424 1..115 100 -> Plus
2R 19291585..19291655 116..186 100 -> Plus

FI17116.hyp Sequence

Translation from 78 to 404

> FI17116.hyp
MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFT
IGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTF
DVELLKVE*

FI17116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
FK506-bp2-PA 108 CG11001-PA 1..108 1..108 576 100 Plus
FKBP59-PB 439 CG4535-PB 14..117 2..105 283 50 Plus
FKBP59-PA 439 CG4535-PA 14..117 2..105 283 50 Plus
Fkbp14-PF 216 CG9847-PF 42..132 18..107 269 53.8 Plus
Fkbp14-PE 216 CG9847-PE 42..132 18..107 269 53.8 Plus

FI17116.pep Sequence

Translation from 78 to 404

> FI17116.pep
MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFT
IGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTF
DVELLKVE*

FI17116.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11585-PA 108 GF11585-PA 1..108 1..108 563 99.1 Plus
Dana\GF14673-PA 440 GF14673-PA 24..118 11..105 301 53.7 Plus
Dana\GF12094-PA 214 GF12094-PA 40..130 18..107 269 53.8 Plus
Dana\GF23032-PA 358 GF23032-PA 253..358 2..108 221 49.5 Plus
Dana\GF18389-PA 137 GF18389-PA 38..129 18..108 217 51.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21957-PA 108 GG21957-PA 1..108 1..108 563 99.1 Plus
Dere\GG10059-PA 439 GG10059-PA 23..117 11..105 288 52.6 Plus
Dere\GG20775-PA 231 GG20775-PA 57..147 18..107 269 53.8 Plus
Dere\GG20671-PA 355 GG20671-PA 250..354 2..107 233 48.1 Plus
Dere\GG18343-PA 138 GG18343-PA 39..130 18..108 210 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23096-PA 108 GH23096-PA 1..108 1..108 559 98.1 Plus
Dgri\GH11297-PA 441 GH11297-PA 24..118 11..105 297 55.8 Plus
Dgri\GH20056-PA 212 GH20056-PA 38..128 18..107 257 52.7 Plus
Dgri\GH18265-PA 138 GH18265-PA 34..131 12..108 221 48 Plus
Dgri\GH21813-PA 365 GH21813-PA 260..364 2..107 221 47.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Fkbp12-PA 108 CG11001-PA 1..108 1..108 576 100 Plus
Fkbp59-PB 439 CG4535-PB 14..117 2..105 283 50 Plus
Fkbp59-PA 439 CG4535-PA 14..117 2..105 283 50 Plus
Fkbp14-PF 216 CG9847-PF 42..132 18..107 269 53.8 Plus
Fkbp14-PE 216 CG9847-PE 42..132 18..107 269 53.8 Plus
Fkbp14-PC 216 CG9847-PC 42..132 18..107 269 53.8 Plus
Fkbp14-PA 216 CG9847-PA 42..132 18..107 269 53.8 Plus
Fkbp14-PD 220 CG9847-PD 42..132 18..107 269 53.8 Plus
CG14715-PA 138 CG14715-PA 39..130 18..108 243 50 Plus
Fkbp39-PA 357 CG6226-PA 252..356 2..107 241 48.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18922-PA 108 GI18922-PA 1..108 1..108 557 97.2 Plus
Dmoj\GI17716-PA 441 GI17716-PA 24..118 11..105 290 54.7 Plus
Dmoj\GI20465-PA 424 GI20465-PA 250..340 18..107 270 52.7 Plus
Dmoj\GI21928-PA 370 GI21928-PA 265..370 2..108 251 47.7 Plus
Dmoj\GI24072-PA 139 GI24072-PA 40..131 18..108 221 51.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17641-PA 108 GL17641-PA 1..108 1..108 556 97.2 Plus
Dper\GL18937-PA 440 GL18937-PA 24..118 11..105 293 54.7 Plus
Dper\GL17491-PA 214 GL17491-PA 40..130 18..107 262 52.7 Plus
Dper\GL24296-PA 342 GL24296-PA 237..338 2..104 226 46.6 Plus
Dper\GL22120-PA 139 GL22120-PA 40..131 18..108 209 47.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10702-PA 108 GA10702-PA 1..108 1..108 556 97.2 Plus
Dpse\GA18239-PA 440 GA18239-PA 24..118 11..105 294 54.7 Plus
Dpse\GA22070-PA 214 GA22070-PA 40..130 18..107 262 52.7 Plus
Dpse\GA26561-PA 341 GA26561-PA 236..337 2..104 226 46.6 Plus
Dpse\GA13197-PA 139 GA13197-PA 40..131 18..108 209 47.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21945-PA 108 GM21945-PA 1..108 1..108 567 100 Plus
Dsec\GM17712-PA 439 GM17712-PA 23..117 11..105 287 52.6 Plus
Dsec\GM15719-PA 231 GM15719-PA 57..147 18..107 269 53.8 Plus
Dsec\GM25784-PA 349 GM25784-PA 244..348 2..107 224 46.2 Plus
Dsec\GM23968-PA 138 GM23968-PA 39..130 18..108 210 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11442-PA 137 GD11442-PA 1..89 1..89 460 97.8 Plus
Dsim\GD23632-PA 402 GD23632-PA 23..117 11..105 282 52.6 Plus
Dsim\GD25197-PA 231 GD25197-PA 57..147 18..107 269 53.8 Plus
Dsim\GD20361-PA 348 GD20361-PA 243..347 2..107 226 47.2 Plus
Dsim\GD18774-PA 138 GD18774-PA 39..130 18..108 210 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19778-PA 108 GJ19778-PA 1..108 1..108 549 95.4 Plus
Dvir\GJ17544-PA 441 GJ17544-PA 24..118 11..105 293 54.7 Plus
Dvir\GJ22316-PA 212 GJ22316-PA 38..128 18..107 258 51.6 Plus
Dvir\GJ19627-PA 62 GJ19627-PA 1..59 1..59 255 83.1 Plus
Dvir\GJ10892-PA 138 GJ10892-PA 40..131 18..108 223 51.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20673-PA 108 GK20673-PA 1..108 1..108 560 98.1 Plus
Dwil\GK23813-PA 440 GK23813-PA 24..118 11..105 307 55.8 Plus
Dwil\GK20742-PA 211 GK20742-PA 37..127 18..107 263 52.7 Plus
Dwil\GK11959-PA 358 GK11959-PA 253..357 2..107 217 48.1 Plus
Dwil\GK22382-PA 139 GK22382-PA 41..132 18..108 212 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\FK506-bp2-PA 108 GE12036-PA 1..108 1..108 556 98.1 Plus
Dyak\FKBP59-PA 439 GE18873-PA 23..117 11..105 290 52.6 Plus
Dyak\Fkbp13-PA 231 GE13712-PA 57..147 18..107 268 53.8 Plus
Dyak\GE26389-PA 353 GE26389-PA 248..352 2..107 237 49.1 Plus
Dyak\GE24193-PA 138 GE24193-PA 39..130 18..108 212 50 Plus