Clone FI17122 Report

Search the DGRC for FI17122

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:171
Well:22
Vector:pFlc-1
Associated Gene/TranscriptRpS3A-RB
Protein status:FI17122.pep: gold
Sequenced Size:840

Clone Sequence Records

FI17122.complete Sequence

840 bp assembled on 2011-11-28

GenBank Submission: BT132838.1

> FI17122.complete
AGTCGGCAAAAATAAAGGTCTTTCCAAGGGTGGTAAGAAGGGCGGTAAGA
AGAAGGTGGTGGACCCGTTTTCTCGCAAGGACTGGTACGATGTCAAAGCT
CCGAATATGTTTCAAACCCGTCAAATCGGGTCGCGTTTTCGAAGTGTCTT
TAGCAGACTTGCAAAAGGATATTGATCCAGAACGTTCTTTTCGCAAGTTC
CGTCTTATTGCAGAAGATGTTCAAGACCGTAATGTGCTCTGTAACTTTCA
CGGAATGGACTTGACTACGGACAAGTACAGGTCGATGGTTAAAAAGTGGC
AAACACTAATTGAAGCTATTGTCGAAGCAAAGACTGTAGATGGGTACCTC
TTGCGAGTGTTTTGTATCGGATTTACTGCCAAGGATCAGCAGTCTCAGCG
CAAAACATGTTATGCTCAGCAATCGCAAGTCCGAAAGATTCGTGCTCGCA
TGACCGACATTATTACTAATGAAGTTAGTGGTGCCGATCTAAAGCAGCTT
GTTAACAAGCTGGCCTTGGACTCGATTGCGAAAGATATCGAAAAAAGCTG
TCAGCGCATATATCCATTACATGATGTTTACATTCGTAAAGTAAAGGTAT
TGAAGAAACCGCGCTTCGATGTCTCAAAGCTTCTGGAATTGCATGGCGAT
GGCGGTGGCAAATCCGTGGAAGCCGTTGTTTCATCCGAGGGAGCCGTAAT
CGACCGCCCTGAAGGTTATGAGCCCCCAGTACAGGAAGCTGTTTAAATTA
AATATGAAATGCATATTTTTTTATGTATTGCATTCAAACATAAAATACAT
TTCTCTACAAATTGCATAAACTAAAAAAAAAAAAAAAAAA

FI17122.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 86831..87374 822..279 2720 100 Minus
chr4 1351717 chr4 87472..87626 282..128 775 100 Minus
chr4 1351717 chr4 87681..87809 129..1 645 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 66196..66740 823..279 2725 100 Minus
4 1348131 4 66838..66992 282..128 775 100 Minus
4 1348131 4 67047..67175 129..1 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 66196..66740 823..279 2725 100 Minus
4 1331231 4 66838..66992 282..128 775 100 Minus
4 1331231 4 67047..67175 129..1 645 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:46:29 has no hits.

FI17122.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:47:40 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 87474..87625 129..280 100 <- Minus
chr4 87682..87809 1..128 100   Minus
chr4 86831..87372 281..822 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-28 13:16:17 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3A-RB 1..657 90..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:19 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3A-RB 1..657 90..746 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:41:55 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3A-RB 1..657 90..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-28 13:16:15 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3A-RB 63..884 1..822 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:19 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3A-RB 33..854 1..822 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:41:55 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3A-RB 33..854 1..822 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:40 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
4 66197..66738 281..822 100 <- Minus
4 66840..66991 129..280 100 <- Minus
4 67048..67175 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:40 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
4 66197..66738 281..822 100 <- Minus
4 66840..66991 129..280 100 <- Minus
4 67048..67175 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:40 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
4 66197..66738 281..822 100 <- Minus
4 66840..66991 129..280 100 <- Minus
4 67048..67175 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:19 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 86823..87364 281..822 100 <- Minus
arm_4 87466..87617 129..280 100 <- Minus
arm_4 87674..87801 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:40:17 Download gff for FI17122.complete
Subject Subject Range Query Range Percent Splice Strand
4 67048..67175 1..128 100   Minus
4 66197..66738 281..822 100 <- Minus
4 66840..66991 129..280 100 <- Minus

FI17122.hyp Sequence

Translation from 2 to 745

> FI17122.hyp
SAKIKVFPRVVRRAVRRRWWTRFLARTGTMSKLRICFKPVKSGRVFEVSL
ADLQKDIDPERSFRKFRLIAEDVQDRNVLCNFHGMDLTTDKYRSMVKKWQ
TLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCYAQQSQVRKIRARM
TDIITNEVSGADLKQLVNKLALDSIAKDIEKSCQRIYPLHDVYIRKVKVL
KKPRFDVSKLLELHGDGGGKSVEAVVSSEGAVIDRPEGYEPPVQEAV*

FI17122.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpS3A-PB 218 CG2168-PB 1..218 30..247 1110 100 Plus
RpS3A-PF 268 CG2168-PF 64..268 43..247 1043 100 Plus
RpS3A-PA 268 CG2168-PA 64..268 43..247 1043 100 Plus

FI17122.pep Sequence

Translation from 2 to 745

> FI17122.pep
SAKIKVFPRVVRRAVRRRWWTRFLARTGTMSKLRICFKPVKSGRVFEVSL
ADLQKDIDPERSFRKFRLIAEDVQDRNVLCNFHGMDLTTDKYRSMVKKWQ
TLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCYAQQSQVRKIRARM
TDIITNEVSGADLKQLVNKLALDSIAKDIEKSCQRIYPLHDVYIRKVKVL
KKPRFDVSKLLELHGDGGGKSVEAVVSSEGAVIDRPEGYEPPVQEAV*

FI17122.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19047-PA 268 GF19047-PA 64..268 43..247 1063 97.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16465-PA 268 GG16465-PA 64..268 43..247 1082 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23985-PA 268 GH23985-PA 64..268 43..247 1052 96.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpS3A-PB 218 CG2168-PB 1..218 30..247 1110 100 Plus
RpS3A-PF 268 CG2168-PF 64..268 43..247 1043 100 Plus
RpS3A-PA 268 CG2168-PA 64..268 43..247 1043 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14113-PA 268 GI14113-PA 64..268 43..247 1064 97.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18386-PA 268 GL18386-PA 64..268 43..247 1071 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15280-PA 268 GA15280-PA 64..268 43..247 1071 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23236-PA 268 GM23236-PA 64..268 43..247 1080 99.5 Plus
Dsec\GM23235-PA 118 GM23235-PA 64..114 43..93 276 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21872-PA 268 GJ21872-PA 64..268 43..247 1070 98 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13664-PA 268 GK13664-PA 64..268 43..247 1063 97.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS3A-PA 268 GE14530-PA 64..268 43..247 1079 99.5 Plus