Clone FI17124 Report

Search the DGRC for FI17124

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:171
Well:24
Vector:pFlc-1
Associated Gene/TranscriptCG4449-RA
Protein status:FI17124.pep: gold
Sequenced Size:1364

Clone Sequence Records

FI17124.complete Sequence

1364 bp assembled on 2011-11-30

GenBank Submission: BT132845.1

> FI17124.complete
GTTTATTGTTTGGCGCCGTTATTGGTTTATTACTGACTGTTACTGAGTGC
CCACGATGTCCGACGACGACTGCGATATATTCAGTGCTGCTCGCAAGCGG
ATTCCCGAAATAGCTTTGCCCAAGAATCCTTACAATCTTGGCAATGATTC
CTTCTCCAAGGAGGTGGACTACGATTTCATTGAAGACCTCCCCAAGAAAT
CAACTAAAACTGGCAAACGAAAGAACCCTGCAGCGACGCGGAAAAATCCA
CCCAAAAGTCAGGATGATGCTTCGCCACCAAAACAGGCAGAACATAAGGC
TGTGGAGCCAGAAGAGGATATGAGAACAGAGCGCTCCCTATCACCGGTAT
CCCTGTTGATATTGGAGATGGAAAAGAAAAATGGCCAGCAATCGGATGTG
GAGAAGCACGCCAAAGAAAATGACGTTGGTCCTGTGGCCAGACGCACACG
GTCATCGTTAAATAGGTCAGAAATGGCGCCACCACCTGTTTCACCGACTG
TGGAGGTGCCCACACAGACGAAACCAAAGAAGCGCGGCCAAAAAAAGAGA
ACATCTCTAACAACCACAACCAGCAACTCTGCTTCGATGGAGGTCTCATT
GCCAAGCATTGTAGGTCAGAACAATGAGCACATTAGCAGACGGTGGACGT
TGGCCGAAGTTGCAGCCCGTTCCAAAGTGGTGGACAGTATTGATCTGGTA
TCTGCGGTCGCTCCCCGAGTGGAGGGATTTGTTAATCTAGACTCTGAAGA
CGAGGGTGAAAAGGAGGCTCCTCCTGTCGTAGAGGAAGAAAATATTTTTG
ATAACGATAATCCCACAATAGAAGTAGCTTTGTCGTGGCTTGGCGAGATC
CAGATTTATAAATTGCGGCAGCACCAAAAGTTTAAGCATCTGTTCAAGGA
GTTAGCATCACGCAATGGGATAGATGAGAATGATATAACGGTGGATATGT
ACTATAACTTCGTTGGACCTGAGGATACGCCGCACAGCATTGGTCTCAAA
TCATTTCATACGCTCACTGGCCATCCAACAAAGAGTCACAATAATAACAA
CGTGGCTGCTAAAATTGACTACAATCCAGAAGCTCTTTGCCGGAAACCTA
AGAAGTTTCAAGTTAAAGTACAGGCGGATAAATGGAAGCATCCTTTGGTG
ATACCCATGAAGAAAACTGATAATTTCAAAATCATATTTATTAAGTGTGC
TGAGGAGTTGAACTGTGATCCCCGAACCATTAAATTGTTTTTTGACGGTG
ACTTGTTGGATCCAAATGATACGCCCAATAACCAGGATATGGAGGGCAAC
GAAGTTATAGATCTTAAAATAAAGGCTTAAATTTTGAGCAAATTTATCCA
AAAAAAAAAAAAAA

FI17124.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19074009..19074513 616..112 2525 100 Minus
chr3R 27901430 chr3R 19073150..19073372 1239..1017 1115 100 Minus
chr3R 27901430 chr3R 19073432..19073611 1016..837 900 100 Minus
chr3R 27901430 chr3R 19073834..19073949 732..617 580 100 Minus
chr3R 27901430 chr3R 19074579..19074691 113..1 565 100 Minus
chr3R 27901430 chr3R 19072983..19073091 1348..1240 545 100 Minus
chr3R 27901430 chr3R 19073665..19073772 838..731 540 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23250600..23251104 616..112 2525 100 Minus
3R 32079331 3R 23249741..23249963 1239..1017 1115 100 Minus
3R 32079331 3R 23250023..23250202 1016..837 900 100 Minus
3R 32079331 3R 23250425..23250540 732..617 580 100 Minus
3R 32079331 3R 23251167..23251279 113..1 565 100 Minus
3R 32079331 3R 23249574..23249682 1348..1240 545 100 Minus
3R 32079331 3R 23250256..23250363 838..731 540 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22991431..22991935 616..112 2525 100 Minus
3R 31820162 3R 22990572..22990794 1239..1017 1115 100 Minus
3R 31820162 3R 22990854..22991033 1016..837 900 100 Minus
3R 31820162 3R 22991256..22991371 732..617 580 100 Minus
3R 31820162 3R 22991998..22992110 113..1 565 100 Minus
3R 31820162 3R 22990405..22990513 1348..1240 545 100 Minus
3R 31820162 3R 22991087..22991194 838..731 540 100 Minus
Blast to na_te.dros performed 2019-03-15 11:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 1417..1463 783..830 111 72.9 Plus
Stalker 7256 Stalker STALKER 7256bp 1309..1355 783..830 111 72.9 Plus

FI17124.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:47:51 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19072982..19073091 1240..1349 99 <- Minus
chr3R 19073150..19073372 1017..1239 100 <- Minus
chr3R 19073432..19073610 838..1016 100 <- Minus
chr3R 19073666..19073772 731..837 100 <- Minus
chr3R 19073836..19073949 617..730 100 <- Minus
chr3R 19074009..19074511 114..616 100 <- Minus
chr3R 19074579..19074691 1..113 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-11-30 08:47:19 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
CG4449-RA 1..1275 56..1330 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:31 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
CG4449-RA 1..1275 56..1330 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:42:18 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
CG4449-RA 1..1275 56..1330 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-11-30 08:47:19 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
CG4449-RA 199..1546 1..1349 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:31 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
CG4449-RA 199..1546 1..1349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:42:18 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
CG4449-RA 199..1546 1..1349 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:51 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23251167..23251279 1..113 100   Minus
3R 23249573..23249682 1240..1349 99 <- Minus
3R 23249741..23249963 1017..1239 100 <- Minus
3R 23250023..23250201 838..1016 100 <- Minus
3R 23250257..23250363 731..837 100 <- Minus
3R 23250427..23250540 617..730 100 <- Minus
3R 23250600..23251102 114..616 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:51 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23251167..23251279 1..113 100   Minus
3R 23249573..23249682 1240..1349 99 <- Minus
3R 23249741..23249963 1017..1239 100 <- Minus
3R 23250023..23250201 838..1016 100 <- Minus
3R 23250257..23250363 731..837 100 <- Minus
3R 23250427..23250540 617..730 100 <- Minus
3R 23250600..23251102 114..616 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:51 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23251167..23251279 1..113 100   Minus
3R 23249573..23249682 1240..1349 99 <- Minus
3R 23249741..23249963 1017..1239 100 <- Minus
3R 23250023..23250201 838..1016 100 <- Minus
3R 23250257..23250363 731..837 100 <- Minus
3R 23250427..23250540 617..730 100 <- Minus
3R 23250600..23251102 114..616 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:31 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19075295..19075404 1240..1349 99 <- Minus
arm_3R 19075463..19075685 1017..1239 100 <- Minus
arm_3R 19075745..19075923 838..1016 100 <- Minus
arm_3R 19075979..19076085 731..837 100 <- Minus
arm_3R 19076149..19076262 617..730 100 <- Minus
arm_3R 19076322..19076824 114..616 100 <- Minus
arm_3R 19076889..19077001 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:40:36 Download gff for FI17124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22990572..22990794 1017..1239 100 <- Minus
3R 22990854..22991032 838..1016 100 <- Minus
3R 22991088..22991194 731..837 100 <- Minus
3R 22991258..22991371 617..730 100 <- Minus
3R 22991431..22991933 114..616 100 <- Minus
3R 22991998..22992110 1..113 100   Minus
3R 22990404..22990513 1240..1349 99 <- Minus

FI17124.hyp Sequence

Translation from 55 to 1329

> FI17124.hyp
MSDDDCDIFSAARKRIPEIALPKNPYNLGNDSFSKEVDYDFIEDLPKKST
KTGKRKNPAATRKNPPKSQDDASPPKQAEHKAVEPEEDMRTERSLSPVSL
LILEMEKKNGQQSDVEKHAKENDVGPVARRTRSSLNRSEMAPPPVSPTVE
VPTQTKPKKRGQKKRTSLTTTTSNSASMEVSLPSIVGQNNEHISRRWTLA
EVAARSKVVDSIDLVSAVAPRVEGFVNLDSEDEGEKEAPPVVEEENIFDN
DNPTIEVALSWLGEIQIYKLRQHQKFKHLFKELASRNGIDENDITVDMYY
NFVGPEDTPHSIGLKSFHTLTGHPTKSHNNNNVAAKIDYNPEALCRKPKK
FQVKVQADKWKHPLVIPMKKTDNFKIIFIKCAEELNCDPRTIKLFFDGDL
LDPNDTPNNQDMEGNEVIDLKIKA*

FI17124.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG4449-PD 424 CG4449-PD 1..424 1..424 2218 100 Plus
CG4449-PA 424 CG4449-PA 1..424 1..424 2218 100 Plus
CG4449-PE 423 CG4449-PE 1..423 1..424 2201 99.8 Plus
CG4449-PC 422 CG4449-PC 1..422 1..424 2195 99.5 Plus
CG4449-PB 422 CG4449-PB 1..422 1..424 2195 99.5 Plus

FI17124.pep Sequence

Translation from 55 to 1329

> FI17124.pep
MSDDDCDIFSAARKRIPEIALPKNPYNLGNDSFSKEVDYDFIEDLPKKST
KTGKRKNPAATRKNPPKSQDDASPPKQAEHKAVEPEEDMRTERSLSPVSL
LILEMEKKNGQQSDVEKHAKENDVGPVARRTRSSLNRSEMAPPPVSPTVE
VPTQTKPKKRGQKKRTSLTTTTSNSASMEVSLPSIVGQNNEHISRRWTLA
EVAARSKVVDSIDLVSAVAPRVEGFVNLDSEDEGEKEAPPVVEEENIFDN
DNPTIEVALSWLGEIQIYKLRQHQKFKHLFKELASRNGIDENDITVDMYY
NFVGPEDTPHSIGLKSFHTLTGHPTKSHNNNNVAAKIDYNPEALCRKPKK
FQVKVQADKWKHPLVIPMKKTDNFKIIFIKCAEELNCDPRTIKLFFDGDL
LDPNDTPNNQDMEGNEVIDLKIKA*

FI17124.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18021-PA 435 GF18021-PA 1..435 1..424 1068 53 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12448-PA 433 GG12448-PA 1..432 1..423 1553 72.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21394-PA 395 GH21394-PA 1..395 1..423 725 42.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rad60-PD 424 CG4449-PD 1..424 1..424 2218 100 Plus
Rad60-PA 424 CG4449-PA 1..424 1..424 2218 100 Plus
Rad60-PE 423 CG4449-PE 1..423 1..424 2201 99.8 Plus
Rad60-PC 422 CG4449-PC 1..422 1..424 2195 99.5 Plus
Rad60-PB 422 CG4449-PB 1..422 1..424 2195 99.5 Plus
Rad60-PF 421 CG4449-PF 1..421 1..424 2189 99.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10504-PA 421 GI10504-PA 1..421 1..423 804 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23037-PA 400 GL23037-PA 1..399 1..423 854 48.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18191-PA 400 GA18191-PA 1..399 1..423 834 47.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23580-PA 418 GM23580-PA 1..418 1..424 1745 86.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18396-PA 419 GD18396-PA 1..419 1..424 1750 87.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23185-PA 405 GJ23185-PA 1..402 1..420 841 47.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13227-PA 406 GK13227-PA 4..405 3..423 894 46.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23972-PA 428 GE23972-PA 1..427 1..423 1655 77.6 Plus