Clone FI17302 Report

Search the DGRC for FI17302

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:173
Well:2
Vector:pFlc-1
Associated Gene/TranscriptCG12895-RA
Protein status:FI17302.pep: gold
Sequenced Size:584

Clone Sequence Records

FI17302.complete Sequence

584 bp assembled on 2011-12-02

GenBank Submission: BT132881.1

> FI17302.complete
ATTGTTTTGGTCGTTTCCTAAAATGTTGCGGCAATTTATAGTATCTACGG
TAGGCCGTCGCCTGCAACTACCTATGATGGCCCAAAGTCGCCTCGCCAGC
AATTTGGACAAAACTGAGTACACAACACCCGGGGAAATTGTGGACTACGA
TGATCCGCCGCATTTGCCAGTTCCGGAATATCCTGTCCGTCCCGATGAGC
CGCTGGAAACTCGCAAGCAGCGCCTTTTGTATCAAAGCAGGAAACGCGGA
ATGCTGGAAAACGATCTCTTGCTGAGCACTTTTGTGGCCAAGCATTTGAA
GGACTTCAATGCCGAGCAGACCGCCGAGTACGATCAGTTGATCAATGGTG
TCAGCAACGACTGGGATATATTCTACTGGGCCACCGATACCAAGCCAACA
CCTCCTCAATTCGATACCGAAATAATGCGTCTGCTAAAGGAGCACGTCAA
AAATCATGAAAAAGTGCAAAGGATAAGGCAGCCGGATTTGTGAACATTAT
AAACTATATTATATATATAAGCATACAAAACAATGTATTAAATGAATGTG
TTATTCTACTCCTGATCCCTAAAAAAAAAAAAAA

FI17302.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6324169..6324517 568..222 1635 98.6 Minus
chr2R 21145070 chr2R 6324579..6324760 222..41 895 99.5 Minus
chr2R 21145070 chr2R 4060141..4060283 387..245 415 86 Minus
chr2R 21145070 chr2R 6324814..6324856 43..1 215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10436668..10437020 574..222 1750 99.7 Minus
2R 25286936 2R 10437082..10437263 222..41 910 100 Minus
2R 25286936 2R 8172607..8172749 387..245 415 86 Minus
2R 25286936 2R 10437317..10437359 43..1 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10437867..10438219 574..222 1750 99.7 Minus
2R 25260384 2R 10438281..10438462 222..41 910 100 Minus
2R 25260384 2R 8173806..8173948 387..245 415 86 Minus
2R 25260384 2R 10438516..10438558 43..1 215 100 Minus
2R 25260384 2R 8174375..8174457 219..137 160 79.5 Minus
Blast to na_te.dros performed on 2019-03-15 11:55:45 has no hits.

FI17302.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:56:47 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6324167..6324516 223..570 98 <- Minus
chr2R 6324579..6324760 41..222 99 <- Minus
chr2R 6324817..6324856 1..40 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 15:59:26 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
CG12895-RA 1..471 23..493 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:38 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
CG12895-RA 1..471 23..493 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:46:11 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
CG12895-RA 1..471 23..493 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 15:59:25 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
CG12895-RA 1..569 1..570 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:38 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
CG12895-RA 24..592 1..570 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:46:11 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
CG12895-RA 24..592 1..570 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:47 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10436672..10437019 223..570 99 <- Minus
2R 10437082..10437263 41..222 100 <- Minus
2R 10437320..10437359 1..40 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:47 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10436672..10437019 223..570 99 <- Minus
2R 10437082..10437263 41..222 100 <- Minus
2R 10437320..10437359 1..40 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:47 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10436672..10437019 223..570 99 <- Minus
2R 10437082..10437263 41..222 100 <- Minus
2R 10437320..10437359 1..40 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:38 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6324587..6324768 41..222 100 <- Minus
arm_2R 6324825..6324864 1..40 100   Minus
arm_2R 6324177..6324524 223..570 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:57 Download gff for FI17302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10437871..10438218 223..570 99 <- Minus
2R 10438281..10438462 41..222 100 <- Minus
2R 10438519..10438558 1..40 100   Minus

FI17302.hyp Sequence

Translation from 0 to 492

> FI17302.hyp
LFWSFPKMLRQFIVSTVGRRLQLPMMAQSRLASNLDKTEYTTPGEIVDYD
DPPHLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLK
DFNAEQTAEYDQLINGVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVK
NHEKVQRIRQPDL*

FI17302.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12895-PB 156 CG12895-PB 1..156 8..163 825 100 Plus
CG12895-PA 156 CG12895-PA 1..156 8..163 825 100 Plus
CG14757-PA 163 CG14757-PA 44..161 46..163 536 82.2 Plus

FI17302.pep Sequence

Translation from 1 to 492

> FI17302.pep
LFWSFPKMLRQFIVSTVGRRLQLPMMAQSRLASNLDKTEYTTPGEIVDYD
DPPHLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLK
DFNAEQTAEYDQLINGVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVK
NHEKVQRIRQPDL*

FI17302.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11110-PA 156 GF11110-PA 1..156 8..163 728 86.5 Plus
Dana\GF11203-PA 163 GF11203-PA 41..158 46..163 532 82.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25208-PA 156 GG25208-PA 1..156 8..163 791 95.5 Plus
Dere\GG10665-PA 162 GG10665-PA 43..160 46..163 525 81.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20634-PA 206 GH20634-PA 51..206 9..163 631 75.6 Plus
Dgri\GH20828-PA 147 GH20828-PA 27..143 46..163 466 75.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12895-PB 156 CG12895-PB 1..156 8..163 825 100 Plus
CG12895-PA 156 CG12895-PA 1..156 8..163 825 100 Plus
CG14757-PA 163 CG14757-PA 44..161 46..163 536 82.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20197-PA 157 GI20197-PA 1..157 8..163 620 74.5 Plus
Dmoj\GI20928-PA 157 GI20928-PA 8..151 18..163 478 65.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17204-PA 157 GL17204-PA 1..157 8..163 692 82.8 Plus
Dper\GL10881-PA 160 GL10881-PA 1..159 8..163 531 66.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25039-PA 157 GA25039-PA 1..157 8..163 694 82.8 Plus
Dpse\GA24523-PA 160 GA24523-PA 42..159 46..163 526 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20523-PA 156 GM20523-PA 1..156 8..163 802 96.8 Plus
Dsec\GM20711-PA 163 GM20711-PA 44..161 46..163 532 82.2 Plus
Dsec\GM19620-PA 80 GM19620-PA 36..72 31..74 131 63.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25982-PA 156 GD25982-PA 1..156 8..163 818 99.4 Plus
Dsim\GD10178-PA 163 GD10178-PA 44..161 46..163 532 82.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20144-PA 158 GJ20144-PA 16..158 21..163 576 74.8 Plus
Dvir\GJ20655-PA 319 GJ20655-PA 197..313 46..163 484 75.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18008-PA 156 GK18008-PA 1..156 8..163 659 76.9 Plus
Dwil\GK15773-PA 157 GK15773-PA 1..156 8..163 496 63.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21507-PA 156 GE21507-PA 1..156 8..163 777 94.9 Plus
Dyak\GE23226-PA 162 GE23226-PA 43..160 46..163 531 83.1 Plus