Clone FI17308 Report

Search the DGRC for FI17308

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:173
Well:8
Vector:pFlc-1
Associated Gene/TranscriptCG44009-RA
Protein status:FI17308.pep: gold
Sequenced Size:567

Clone Sequence Records

FI17308.complete Sequence

567 bp assembled on 2011-12-01

GenBank Submission: BT132855.1

> FI17308.complete
GTTGTGTTTTGATATTCCCACTGCATCGCATTTAATTTATTAAAAGCTGT
TACCAAATTATGTCCTACGCCGGCTATAGCCAGCTGCCCAGCGGCAGCGA
CCAGGAGCGCAGGCAGGCGCAGCTCGCGGCCAGCACCTACGACGTGCTAC
AGCGGACGACGGACAGTATCCAGCGATCCAACCAGATTGCCATCGAAACG
GAGAACATGGGGGCGGAGGTACTCGGCGAACTGGGCGAGCAGAGGGAGTC
GCTGCTACGCACCACGCGCCGCCTGGAGGACGCCGATCAGGATCTGTCCA
AATCGAGGGTCATCATTCGGAAGTTGAGCAGGGAGGTGCTCTACAACAAG
ATCATCCTAATCCTGATTATCATTCTGGAGGTGGGCATACTCGTCGGCTT
GCTGGTGCTGAAGTTCGCTCACCTGTGAGCCAATGCCATTCTATTCCAAA
GTCGTAACCACCAAACAGGCGATGGACTATATATACCTATTAATCGTTAC
GAATTCTTTGTCCTAGTTAATAAGCTTATAAATGTATATACTCCACTAAA
AGAAAAAAAAAAAAAAA

FI17308.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14224207..14224541 217..551 1660 99.7 Plus
chr3R 27901430 chr3R 14223931..14224151 1..221 1060 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18400009..18400343 217..551 1675 100 Plus
3R 32079331 3R 18399733..18399953 1..221 1090 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18140840..18141174 217..551 1675 100 Plus
3R 31820162 3R 18140564..18140784 1..221 1090 99.5 Plus
Blast to na_te.dros performed on 2019-03-15 11:50:25 has no hits.

FI17308.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:51:24 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14223931..14224148 1..218 98 -> Plus
chr3R 14224209..14224541 219..552 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-01 13:24:06 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RF 1..369 60..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:15 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
CG44009-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:43:39 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
CG44009-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-01 13:24:06 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RF 1..551 1..552 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:15 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
CG44009-RA 25..571 1..547 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:43:39 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
CG44009-RA 25..571 1..547 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:24 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18399733..18399950 1..218 99 -> Plus
3R 18400011..18400343 219..552 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:24 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18399733..18399950 1..218 99 -> Plus
3R 18400011..18400343 219..552 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:24 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18399733..18399950 1..218 99 -> Plus
3R 18400011..18400343 219..552 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:15 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14225455..14225672 1..218 99 -> Plus
arm_3R 14225733..14226065 219..552 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:22 Download gff for FI17308.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18140842..18141174 219..552 99   Plus
3R 18140564..18140781 1..218 99 -> Plus

FI17308.hyp Sequence

Translation from 59 to 427

> FI17308.hyp
MSYAGYSQLPSGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENM
GAEVLGELGEQRESLLRTTRRLEDADQDLSKSRVIIRKLSREVLYNKIIL
ILIIILEVGILVGLLVLKFAHL*

FI17308.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG44009-PA 122 CG44009-PA 1..122 1..122 583 100 Plus
CG44009-PB 73 CG44009-PB 1..73 50..122 342 100 Plus

FI17308.pep Sequence

Translation from 59 to 427

> FI17308.pep
MSYAGYSQLPSGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENM
GAEVLGELGEQRESLLRTTRRLEDADQDLSKSRVIIRKLSREVLYNKIIL
ILIIILEVGILVGLLVLKFAHL*

FI17308.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16902-PA 123 GF16902-PA 1..123 1..122 504 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18342-PA 123 GH18342-PA 1..123 1..122 435 82.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Vti1b-PA 122 CG44009-PA 1..122 1..122 583 100 Plus
Vti1b-PB 73 CG44009-PB 1..73 50..122 342 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23323-PA 123 GI23323-PA 1..123 1..122 450 82.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24343-PA 122 GL24343-PA 1..122 1..122 469 92.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30142-PC 353 GA30142-PC 1..122 1..122 475 92.6 Plus
Dpse\GA23298-PA 122 GA23298-PA 1..122 1..122 469 92.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17868-PA 426 GM17868-PA 65..155 5..97 432 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19230-PA 350 GD19230-PA 65..157 5..97 456 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10326-PA 123 GJ10326-PA 1..123 1..122 450 84.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13085-PA 120 GK13085-PA 1..96 1..97 366 77.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25536-PA 122 GE25536-PA 1..122 1..122 597 96.7 Plus