Clone FI17311 Report

Search the DGRC for FI17311

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:173
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG5550-RA
Protein status:FI17311.pep: gold
Sequenced Size:940

Clone Sequence Records

FI17311.complete Sequence

940 bp assembled on 2011-12-14

GenBank Submission: BT132920.1

> FI17311.complete
GATAGTCGTTTCGAGCCAACACAATGAAACCCATTTGCTTCGCACTCTGC
GTATTTTCGCTAGGCCTTTTCTATTTGGCCAGCGCTGAGATTGGTGAAAA
TGTGAAGATCCAGACGTACAAGAAGTATAGTTCATCCTGCAAGGAGTTGA
ACCCAAAGAAGAGCGGTGTCCAGAAGATCCAAGTGGGCTCCGATGTAATC
GAAGTGTACTGCGATGTGACAATCGCCGGAAAGGGCTGGCTGGTCGTCCA
GCGAAGAGTCAGTGTGGAGGAGAACTTCTACCGCAATTGGACCTCTTATC
AGACGGGTTTCGGTGACCTTAAGGGTAACTTCTTCATCGGATTGAATAAT
CTGAACAAGATCTCGTCCCTGCAACCCCAAGAGTTGTATATTGAGTTGGT
GGACTTTGCTGGCGAGAAGCGGTATGCCCACTACAGTGTGTTTCACGTGG
GCAACGTGTACAGTAATTACCCGATAACCCAGCTGGGCGCGTACAGTGGA
ACCGCCGGAGACAGTTTGAGCTATCATCTGTACCAACCTTTCAGCACCTT
CGATAGGGATAACGACAATGCCACTATCAACTGTGCTGCCAGATATATGG
GAGCCTGGTGGTACAGAGAATGCCTTAGCAGCAATCTGAATGGTGCATAT
CTGGGTGGAAACCACACCGATCCCGCGCTGTTTGGCTCTGGAATCGTTTG
GGGAGAATGGAAGGGCTTCACATACAGCTACAAGACTGTTAACATTATGG
TGCGACCAAAATAAGTCCTTGATACTTTAGAAGTACTTGTTTAACTGACT
AGATAACTGCCTAAAACTATGAGCTGATTAGTTATTTGCTAACAGTAAAA
AACTTACCAATAGTTATACATTCAATTTATTTATTTACCTATTTTAATTA
TGTAAATATATCTAAATAGATTGCAAAAAAAAAAAAAAAA

FI17311.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12703782..12704412 1..631 3125 99.7 Plus
chr2R 21145070 chr2R 12704464..12704765 623..924 1435 98.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16816591..16817221 1..631 3155 100 Plus
2R 25286936 2R 16817281..16817578 628..925 1490 100 Plus
Blast to na_te.dros performed 2019-03-15 12:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dhyd\Bungy 227 Dhyd\Bungy DH14600 227bp Derived from U14600 (Rel. 63, Last updated, Version 2). 108..146 875..913 123 79.5 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1029..1095 847..915 123 68.1 Plus

FI17311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:02:14 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12703782..12704412 1..631 99 -> Plus
chr2R 12704473..12704765 632..924 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-14 10:09:10 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG5550-RA 1..741 24..764 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:52:15 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG5550-RA 1..741 24..764 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:49:04 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG5550-RA 1..741 24..764 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-14 10:09:09 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG5550-RA 1..924 1..924 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:52:15 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG5550-RA 3..926 1..924 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:49:04 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG5550-RA 3..926 1..924 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:14 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16816591..16817221 1..631 100 -> Plus
2R 16817285..16817577 632..924 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:14 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16816591..16817221 1..631 100 -> Plus
2R 16817285..16817577 632..924 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:14 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16816591..16817221 1..631 100 -> Plus
2R 16817285..16817577 632..924 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:52:15 Download gff for FI17311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12704096..12704726 1..631 100 -> Plus
arm_2R 12704790..12705082 632..924 100   Plus

FI17311.hyp Sequence

Translation from 23 to 763

> FI17311.hyp
MKPICFALCVFSLGLFYLASAEIGENVKIQTYKKYSSSCKELNPKKSGVQ
KIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLK
GNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYP
ITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYREC
LSSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK*

FI17311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG5550-PA 246 CG5550-PA 1..246 1..246 1331 100 Plus
CG5550-PB 250 CG5550-PB 1..250 1..246 1316 98.4 Plus
CG30281-PA 291 CG30281-PA 66..274 37..246 535 46.9 Plus
CG30280-PB 272 CG30280-PB 50..263 35..246 516 42.5 Plus
CG9500-PA 272 CG9500-PA 56..267 34..246 506 46.7 Plus

FI17311.pep Sequence

Translation from 23 to 763

> FI17311.pep
MKPICFALCVFSLGLFYLASAEIGENVKIQTYKKYSSSCKELNPKKSGVQ
KIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLK
GNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYP
ITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYREC
LSSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK*

FI17311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11412-PA 407 GF11412-PA 1..244 1..242 813 61.1 Plus
Dana\GF19798-PA 240 GF19798-PA 1..238 1..245 610 50.4 Plus
Dana\GF13288-PA 288 GF13288-PA 50..273 22..246 539 45.1 Plus
Dana\GF19835-PA 256 GF19835-PA 20..247 21..246 514 44.3 Plus
Dana\GF12978-PA 248 GF12978-PA 18..244 24..246 468 44.1 Plus
Dana\GF11412-PA 407 GF11412-PA 266..401 99..233 425 59.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20632-PA 246 GG20632-PA 1..246 1..246 1259 93.9 Plus
Dere\GG22162-PA 291 GG22162-PA 66..274 37..246 526 47.9 Plus
Dere\GG23629-PA 277 GG23629-PA 61..272 34..246 519 48.6 Plus
Dere\GG22161-PA 288 GG22161-PA 64..279 33..246 507 42.6 Plus
Dere\GG22010-PA 318 GG22010-PA 117..316 47..246 464 46.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20745-PA 242 GH20745-PA 8..240 13..245 643 52.1 Plus
Dgri\GH21158-PA 243 GH21158-PA 1..242 1..246 596 49 Plus
Dgri\GH20551-PA 273 GH20551-PA 43..265 20..246 530 46.1 Plus
Dgri\GH13721-PA 331 GH13721-PA 138..326 57..246 468 47.1 Plus
Dgri\GH13963-PA 233 GH13963-PA 18..232 18..245 451 42.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5550-PA 246 CG5550-PA 1..246 1..246 1331 100 Plus
CG5550-PB 250 CG5550-PB 1..250 1..246 1316 98.4 Plus
CG30281-PA 291 CG30281-PA 66..274 37..246 535 46.9 Plus
CG30280-PD 288 CG30280-PD 66..279 35..246 516 42.5 Plus
CG9500-PB 292 CG9500-PB 76..287 34..246 506 46.7 Plus
CG8642-PB 429 CG8642-PB 237..413 66..246 440 47.8 Plus
CG31832-PB 227 CG31832-PB 54..225 70..246 426 46.9 Plus
CG6788-PA 358 CG6788-PA 158..356 46..246 388 39.2 Plus
CG41520-PD 627 CG41520-PD 408..615 45..246 379 37.3 Plus
CG41520-PA 745 CG41520-PA 526..733 45..246 379 37.3 Plus
CG1791-PC 333 CG1791-PC 126..329 45..245 374 38.5 Plus
CG1791-PA 334 CG1791-PA 127..330 45..245 374 38.5 Plus
CG1791-PB 195 CG1791-PB 8..191 63..245 366 40.5 Plus
CG10359-PG 459 CG10359-PG 240..449 33..245 363 40 Plus
CG10359-PE 485 CG10359-PE 266..475 33..245 363 40 Plus
CG41520-PB 729 CG41520-PB 526..717 45..246 334 34.4 Plus
CG1889-PC 332 CG1889-PC 125..329 45..246 318 39.3 Plus
CG1889-PA 332 CG1889-PA 125..329 45..246 318 39.3 Plus
CG1889-PD 338 CG1889-PD 131..335 45..246 318 39.3 Plus
CG9593-PB 382 CG9593-PB 144..370 28..245 294 31.5 Plus
CG7668-PC 422 CG7668-PC 250..420 61..245 261 35.1 Plus
CG7668-PA 422 CG7668-PA 250..420 61..245 261 35.1 Plus
sca-PB 799 CG17579-PB 525..709 25..209 254 31.4 Plus
sca-PA 799 CG17579-PA 525..709 25..209 254 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20830-PA 239 GI20830-PA 7..237 10..245 667 53.2 Plus
Dmoj\GI18820-PA 211 GI18820-PA 6..203 48..246 513 49.5 Plus
Dmoj\GI18819-PA 214 GI18819-PA 6..192 61..246 492 50.3 Plus
Dmoj\GI21406-PA 397 GI21406-PA 159..392 20..246 487 41.5 Plus
Dmoj\GI21094-PA 389 GI21094-PA 162..384 33..245 484 43.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11776-PA 236 GL11776-PA 3..218 30..246 530 47.7 Plus
Dper\GL26043-PA 453 GL26043-PA 260..451 56..246 456 45.6 Plus
Dper\GL25703-PA 356 GL25703-PA 140..354 30..246 449 43.7 Plus
Dper\GL26064-PA 458 GL26064-PA 254..447 55..246 449 45.4 Plus
Dper\GL26267-PA 193 GL26267-PA 11..188 68..246 414 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15749-PA 293 GA15749-PA 52..275 21..246 536 47.1 Plus
Dpse\GA24068-PA 281 GA24068-PA 63..274 37..246 526 45.3 Plus
Dpse\GA25261-PA 262 GA25261-PA 58..251 55..246 455 46.2 Plus
Dpse\GA28101-PA 220 GA28101-PA 27..215 57..246 452 45 Plus
Dpse\GA25399-PA 201 GA25399-PA 1..199 48..246 443 46.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21726-PA 246 GM21726-PA 1..246 1..246 1289 98 Plus
Dsec\GM15883-PA 292 GM15883-PA 52..275 22..246 525 46.5 Plus
Dsec\GM17946-PA 293 GM17946-PA 77..288 34..246 512 47.7 Plus
Dsec\GM15881-PA 288 GM15881-PA 66..279 35..246 505 42.5 Plus
Dsec\GM14577-PA 227 GM14577-PA 24..225 38..246 427 42.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11221-PA 246 GD11221-PA 1..246 1..246 1306 99.2 Plus
Dsim\GD11645-PA 292 GD11645-PA 52..275 22..246 530 46.5 Plus
Dsim\GD22585-PA 292 GD22585-PA 77..287 35..246 512 47.9 Plus
Dsim\GD11644-PA 288 GD11644-PA 66..279 35..246 505 42.5 Plus
Dsim\GD11489-PA 192 GD11489-PA 4..190 59..246 435 46.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20563-PA 242 GJ20563-PA 8..240 13..245 665 53.4 Plus
Dvir\GJ23826-PA 241 GJ23826-PA 28..241 33..246 608 54.4 Plus
Dvir\GJ21846-PA 238 GJ21846-PA 1..216 33..246 539 49.5 Plus
Dvir\GJ21847-PA 226 GJ21847-PA 2..218 29..246 516 45.7 Plus
Dvir\GJ12860-PA 287 GJ12860-PA 65..280 30..246 500 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22020-PA 249 GK22020-PA 27..249 26..246 658 52.9 Plus
Dwil\GK20369-PA 234 GK20369-PA 15..229 33..246 577 50.5 Plus
Dwil\GK19386-PA 223 GK19386-PA 3..214 37..246 521 46.7 Plus
Dwil\GK21394-PA 313 GK21394-PA 48..272 20..246 521 46.9 Plus
Dwil\GK15364-PA 211 GK15364-PA 10..207 48..246 492 48.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11822-PA 246 GE11822-PA 1..246 1..246 1275 96.7 Plus
Dyak\GE12242-PA 288 GE12242-PA 52..275 22..246 529 45.1 Plus
Dyak\GE18450-PA 249 GE18450-PA 33..244 34..246 510 47.4 Plus
Dyak\GE12241-PA 288 GE12241-PA 66..279 35..246 506 43 Plus
Dyak\GE22879-PA 418 GE22879-PA 227..403 66..246 443 47.8 Plus