Clone FI17338 Report

Search the DGRC for FI17338

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:173
Well:38
Vector:pFlc-1
Associated Gene/TranscriptObp18a-RA
Protein status:FI17338.pep: gold
Sequenced Size:765

Clone Sequence Records

FI17338.complete Sequence

765 bp assembled on 2011-12-03

GenBank Submission: BT132898.1

> FI17338.complete
GGTTAGTTGGGAAACAGATTTTCGCCATGAAGGTTGTGTGCAGCATAGCT
GTACTATGGATTTGCTTGATAACTATGTGGCAATCAGCTGGCCGCGTTAA
CGCAGAGGGTTGCCTAAAGCACCACAATCTGACCAGTGCCCAAGTGCAGG
CAGTGGCTCCATCCACTCCCGTTGCGGATGTTCCAGTGGCCGTTAAGTGC
TATAGCCGGTGTCTGATCCAGGATTATTTCGGTGATGATGGGAAAATCGA
TCTGCAGAAGGTGGGAAAGCGAGGATCTCAAGAGGACCACGTGATTTTGT
CCCAGTGTAAGCAGCAGTTCGATGGCGTCACCAATCTGGACACGTGCGAC
TATCCATACCTGATTCTCCAGTGTTATTTTAAGGGCAAGCAGAGTGGAAC
TATCGCCTCGTAATTTACCAAATAAACAAAAAATAAAGTATACATATATA
CATTACTACATACATATATGTACACACACATGACAGACACAATGGGCTTC
ATCACAGTTCATTGTTGAGTCTTCTAATCAGATCAAACGCCCTCTAATGG
AAATTACACACGATTGTGCTTAGTATAAGTGTGATTTTCATTATTATTAT
TTGTATACAGTGATTAATAATTGTATTAGAGCAAAATAGTAGACATGCAT
TGTTTTAAACTCGTCTGCTTTTTATTGATTTGTTTTATGCAAAGTAACGT
AGAACTGGTGGAAATACATAATGCAATAATAAGTCAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

FI17338.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19023932..19024591 735..77 3205 99.4 Minus
chrX 22417052 chrX 19024645..19024720 77..2 380 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19135079..19135739 737..77 3305 100 Minus
X 23542271 X 19135793..19135868 77..2 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19143177..19143837 737..77 3305 100 Minus
X 23527363 X 19143891..19143966 77..2 380 100 Minus
Blast to na_te.dros performed 2019-03-15 11:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1121..1193 585..659 127 65.3 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1022..1235 412..628 125 54.5 Plus
accord2 7650 accord2 QBERT 7650bp 6263..6299 570..606 122 81.1 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 7023..7116 659..563 110 60.6 Minus

FI17338.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:57:08 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19023932..19024176 492..735 99 == Minus
chrX 19024229..19024590 78..439 99 <- Minus
chrX 19024645..19024720 1..77 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-03 15:36:38 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 1..387 27..413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:51:03 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 1..387 27..413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:46:58 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 1..387 27..413 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-03 15:36:37 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 1..734 2..735 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:51:03 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 1..734 2..735 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:46:58 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 1..734 2..735 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:57:08 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
X 19135793..19135868 1..77 98   Minus
X 19135081..19135738 78..735 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:57:08 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
X 19135793..19135868 1..77 98   Minus
X 19135081..19135738 78..735 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:57:08 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
X 19135793..19135868 1..77 98   Minus
X 19135081..19135738 78..735 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:51:03 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19029114..19029771 78..735 100 <- Minus
arm_X 19029826..19029901 1..77 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:46:12 Download gff for FI17338.complete
Subject Subject Range Query Range Percent Splice Strand
X 19143179..19143836 78..735 100 <- Minus
X 19143891..19143966 1..77 98   Minus

FI17338.hyp Sequence

Translation from 2 to 412

> FI17338.hyp
LVGKQIFAMKVVCSIAVLWICLITMWQSAGRVNAEGCLKHHNLTSAQVQA
VAPSTPVADVPVAVKCYSRCLIQDYFGDDGKIDLQKVGKRGSQEDHVILS
QCKQQFDGVTNLDTCDYPYLILQCYFKGKQSGTIAS*

FI17338.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Obp18a-PA 128 CG15883-PA 1..128 9..136 686 100 Plus

FI17338.pep Sequence

Translation from 2 to 412

> FI17338.pep
LVGKQIFAMKVVCSIAVLWICLITMWQSAGRVNAEGCLKHHNLTSAQVQA
VAPSTPVADVPVAVKCYSRCLIQDYFGDDGKIDLQKVGKRGSQEDHVILS
QCKQQFDGVTNLDTCDYPYLILQCYFKGKQSGTIAS*

FI17338.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19979-PA 105 GF19979-PA 9..103 34..129 286 53.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24733-PA 123 GH24733-PA 8..104 29..124 235 42.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Obp18a-PA 128 CG15883-PA 1..128 9..136 686 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp18a-PA 128 GD15603-PA 1..128 9..136 640 93.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18860-PA 119 GK18860-PA 10..116 36..133 244 45.8 Plus
Dwil\GK20987-PA 116 GK20987-PA 6..115 15..127 146 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15476-PA 127 GE15476-PA 1..124 9..132 563 83.9 Plus