Clone FI17341 Report

Search the DGRC for FI17341

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:173
Well:41
Vector:pFlc-1
Associated Gene/TranscriptGstZ2-RC
Protein status:FI17341.pep: gold
Sequenced Size:1103

Clone Sequence Records

FI17341.complete Sequence

1103 bp assembled on 2011-12-02

GenBank Submission: BT132880.1

> FI17341.complete
GAGTCTATCGCTGGCGTTGCTCCTGTCTGGACACCATGAATCATCCAATA
CTCTACTCGTATTGGCGCAGCTCGTGCTCCTGGCGCGTGCGCATTGCGAT
GAACCTGAAGGAGATACCCTACGACATCAAGCCGATCAGCCTGATCAAAT
CCGGTGGCGAGCAGCACTGCAATGAGTACCGCGAGGTGAATCCAATGGAG
CAGGTGCCCGCCCTACAGATTGATGGACACACCCTCATCGAATCGGTAGC
CATAATGCACTACCTGGAGGAAACACGTCCCCAGCGACCACTCCTGCCAC
AGGACGTCCACAAGCGGGCCAAGGTGCGCGAAATAGTCGAGATCATTTGC
TCTGGCATCCAGCCCCTGCAGAACCTCATCGTGCTCATCCATGTGGGCGA
GGAGAAGAAGAAGGAGTGGGCCCAGCACTGGATTACACGAGGCTTCCGGG
CGGTTGAGAAGGCGCTGTCCACTTCGGCCGGCAAATATTGCGTGGGCGAT
GAGATCTCCATGGCGGACTGCTGCCTCGTACCTCAGGTGTTCAATGCCCG
AAGATTCCACGTCGACTTGCGACCGTATCCCATAATTCTGCGCATCGATC
GCGAACTGGAGAGCAATCCGGCATTCCGGGCGGCCCATCCCTCCAATCAA
CCGGACTGTCCGCCGGAGCTGCCCAACAAATAGAATTTTCCGACCCCAAC
TGCAAAGCGCCGTAAGACGAAAAAGTGAATTGCAGTTCGTAAACCAGGCA
CAAGACAAACTAAGAACTTAAATCTGATCGGTGGGCACGTGGATGGCGAT
GGCGATGGAGAATGGATTGGATAGGATGGCAAAGCTGGCGAGGATTCCAT
TAAGCAGAAACAGTCGGATGTGATTTAAGAAATTGCTAACAGCATTTAAA
TATGCATAAATGCATAAAAATACTATCGATAACATAACGAAATTCCTCAC
ACGAAATTCAAACGCAAACGCAAACGCAAAATTCTCAGAAAACGGAACAA
AAAATCGTATAATAAATTCTTCAAATTCCCTTAGTTTGTCATTGTGAATA
TGATCTAAAAGATGAACTCATATATATTAAATGTAACTCAAAAAAAAAAA
AAA

FI17341.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5283436..5283972 1088..552 2685 100 Minus
chr3R 27901430 chr3R 5284048..5284379 553..222 1660 100 Minus
chr3R 27901430 chr3R 5284440..5284617 222..45 890 100 Minus
chr3R 27901430 chr3R 5284973..5285015 44..2 215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9457591..9458127 1088..552 2685 100 Minus
3R 32079331 3R 9458203..9458534 553..222 1660 100 Minus
3R 32079331 3R 9458595..9458772 222..45 890 100 Minus
3R 32079331 3R 9459128..9459170 44..2 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9198422..9198958 1088..552 2685 100 Minus
3R 31820162 3R 9199034..9199365 553..222 1660 100 Minus
3R 31820162 3R 9199426..9199603 222..45 890 100 Minus
3R 31820162 3R 9199959..9200001 44..2 215 100 Minus
3R 31820162 3R 9196617..9196748 548..417 165 75 Minus
Blast to na_te.dros performed 2019-03-15 11:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 6090..6308 847..1067 126 55.8 Plus

FI17341.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:55:25 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5283435..5283970 554..1089 99 <- Minus
chr3R 5284048..5284378 223..553 100 <- Minus
chr3R 5284440..5284617 45..222 100 <- Minus
chr3R 5284973..5285015 1..44 97   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 15:41:07 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RC 1..648 36..683 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:16 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RC 1..648 36..683 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:45:32 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RC 1..648 36..683 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 15:41:06 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RC 1..1031 2..1032 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:16 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RC 6..1093 1..1088 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:45:32 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RC 6..1093 1..1088 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:25 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9457590..9458125 554..1089 99 <- Minus
3R 9458203..9458533 223..553 100 <- Minus
3R 9458595..9458772 45..222 100 <- Minus
3R 9459128..9459170 1..44 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:25 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9457590..9458125 554..1089 99 <- Minus
3R 9458203..9458533 223..553 100 <- Minus
3R 9458595..9458772 45..222 100 <- Minus
3R 9459128..9459170 1..44 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:25 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9457590..9458125 554..1089 99 <- Minus
3R 9458203..9458533 223..553 100 <- Minus
3R 9458595..9458772 45..222 100 <- Minus
3R 9459128..9459170 1..44 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:16 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5284317..5284494 45..222 100 <- Minus
arm_3R 5284850..5284892 1..44 97   Minus
arm_3R 5283312..5283847 554..1089 99 <- Minus
arm_3R 5283925..5284255 223..553 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:49 Download gff for FI17341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9198421..9198956 554..1089 99 <- Minus
3R 9199034..9199364 223..553 100 <- Minus
3R 9199426..9199603 45..222 100 <- Minus
3R 9199959..9200001 1..44 97   Minus

FI17341.hyp Sequence

Translation from 2 to 682

> FI17341.hyp
VYRWRCSCLDTMNHPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKS
GGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETRPQRPLLPQ
DVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRA
VEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDR
ELESNPAFRAAHPSNQPDCPPELPNK*

FI17341.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
GstZ2-PC 215 CG9363-PC 1..215 12..226 1156 100 Plus
GstZ2-PB 220 CG9363-PB 3..220 9..226 1139 97.7 Plus
GstZ2-PA 227 CG9363-PA 16..227 15..226 1137 100 Plus
GstZ1-PA 246 CG9362-PA 34..246 15..226 789 67.1 Plus
gfzf-PD 234 CG33546-PD 3..181 17..195 147 25.5 Plus

FI17341.pep Sequence

Translation from 2 to 682

> FI17341.pep
VYRWRCSCLDTMNHPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKS
GGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETRPQRPLLPQ
DVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRA
VEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDR
ELESNPAFRAAHPSNQPDCPPELPNK*

FI17341.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17762-PA 220 GF17762-PA 3..220 9..226 1132 97.7 Plus
Dana\GF17763-PA 250 GF17763-PA 37..249 15..226 701 60.1 Plus
Dana\GF12161-PA 223 GF12161-PA 7..200 16..209 149 27.9 Plus
Dana\GF17320-PA 1018 GF17320-PA 790..970 17..197 149 24.7 Plus
Dana\GF12160-PA 223 GF12160-PA 7..206 16..215 148 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17371-PA 220 GG17371-PA 3..220 9..226 1132 97.7 Plus
Dere\GG17372-PA 246 GG17372-PA 29..246 10..226 772 64.2 Plus
Dere\GG10036-PA 1042 GG10036-PA 814..994 17..197 167 26.3 Plus
Dere\GG21881-PA 223 GG21881-PA 7..180 16..191 149 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19138-PA 220 GH19138-PA 3..220 9..226 1130 97.2 Plus
Dgri\GH19140-PA 247 GH19140-PA 29..242 15..226 740 63.1 Plus
Dgri\GH19139-PA 218 GH19139-PA 19..214 15..218 714 67.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
GstZ2-PC 215 CG9363-PC 1..215 12..226 1156 100 Plus
GstZ2-PB 220 CG9363-PB 3..220 9..226 1139 97.7 Plus
GstZ2-PA 227 CG9363-PA 16..227 15..226 1137 100 Plus
GstZ1-PA 246 CG9362-PA 34..246 15..226 789 67.1 Plus
gfzf-PD 234 CG33546-PD 3..181 17..195 147 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23596-PA 220 GI23596-PA 3..220 9..226 1130 97.2 Plus
Dmoj\GI23597-PA 246 GI23597-PA 34..246 15..226 788 69.6 Plus
Dmoj\GI20133-PA 225 GI20133-PA 6..205 12..210 146 24.5 Plus
Dmoj\GI20122-PA 221 GI20122-PA 1..198 12..208 141 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13668-PA 240 GL13668-PA 3..240 9..226 1102 89.5 Plus
Dper\GL13669-PA 256 GL13669-PA 44..256 15..226 797 68.2 Plus
Dper\GL12196-PA 1039 GL12196-PA 810..989 17..195 151 25.9 Plus
Dper\GL15503-PA 241 GL15503-PA 35..197 28..185 144 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21732-PA 220 GA21732-PA 3..220 9..226 1132 97.7 Plus
Dpse\GA21731-PA 231 GA21731-PA 19..231 15..226 794 68.2 Plus
Dpse\GA26222-PB 232 GA26222-PB 3..182 17..195 157 25.9 Plus
Dpse\GA26222-PA 1039 GA26222-PA 810..989 17..195 153 25.9 Plus
Dpse\GA23844-PA 241 GA23844-PA 35..197 28..185 142 26.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26256-PA 220 GM26256-PA 3..220 9..226 1132 97.7 Plus
Dsec\GM26257-PA 246 GM26257-PA 29..246 10..226 787 65.6 Plus
Dsec\GM10504-PA 265 GM10504-PA 35..213 17..195 171 27.2 Plus
Dsec\GM21880-PA 222 GM21880-PA 18..202 29..212 143 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20795-PA 220 GD20795-PA 3..220 9..226 1132 97.7 Plus
Dsim\GD20796-PA 246 GD20796-PA 29..246 10..226 795 66.5 Plus
Dsim\GD19500-PA 1038 GD19500-PA 808..986 17..195 169 27.2 Plus
Dsim\GD11374-PA 222 GD11374-PA 18..202 29..212 147 26.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23570-PA 220 GJ23570-PA 3..220 9..226 1130 97.2 Plus
Dvir\GJ23571-PA 162 GJ23571-PA 1..162 65..226 669 75.3 Plus
Dvir\GJ19903-PA 228 GJ19903-PA 2..205 7..209 153 24.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12126-PA 220 GK12126-PA 3..220 9..226 1132 97.7 Plus
Dwil\GK12127-PA 246 GK12127-PA 25..243 5..222 716 58.4 Plus
Dwil\GK12738-PA 1061 GK12738-PA 832..1012 17..197 164 25.3 Plus
Dwil\GK23004-PA 226 GK23004-PA 5..201 15..209 146 23.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24775-PA 220 GE24775-PA 3..220 9..226 1132 97.7 Plus
Dyak\GE24777-PA 246 GE24777-PA 32..246 13..226 784 66 Plus
Dyak\GE25813-PA 1042 GE25813-PA 814..992 17..195 167 27.2 Plus
Dyak\GE11962-PA 222 GE11962-PA 18..205 29..215 147 27.7 Plus